Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr32370gst3XFF4834R_chr32370probable glutathione transferase

gst3 XFF4834R_chr32370
XFF4834R_chr32360
XFF4834R_chr32360
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr32380
XFF4834R_chr32380
ID gst3
AC XFF4834R_chr32370
LT XFF4834R_chr32370
OR XFF4834R_chr from 3724976 to 3725632 on strand -
DE probable glutathione transferase
IP Intracellular chloride channel; Glutathione S-transferase, N-terminal; Glutathione S-transferase, C-terminal-like; Glutathione S-transferase, predicted
CL 5.6 Protection GO:0006950
EC
GO InterPro


Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100521)
MW 23524.5 Da
SQ 218 aa
 
........10........20........30........40........50
| | | | |
MSTEIVLYTHPLSRGRVARWMLEETGLPYRAVILDYGTTMKAPDYLAINP
MGKVPALRHGDTVVTENAAICAYLADLVPERHLAPPPGSPARADYYRWLF
FLAGPVEALLTAKESGVLAPARSAGYGHEADLLQTLEQAVAGREHLAGEC
FSAADLYMAAVVGFYTRTGVLEPRPAFTAFAQRHAARPAALHANATDDAL
IAAHPNPDMPRTVDTTNS
XFF4834R

XFF4834R_chr30370 lcl|XFF4834R_chr32980207_3488842_r3_XFF4834R-XFF4834R_chr30370

7

107

S=194 I=44 E=2.75622e-17

predicted enzyme

XFF4834R

XFF4834R_chr10130 lcl|gst-XFF4834R_chr10130

3

170

S=166 I=30 E=7.89573e-14

glutathionine S-transferase

XFF4834R

XFF4834R_chr24050 lcl|XFF4834R_chr26240973_2773731_r1_XFF4834R-XFF4834R_chr24050

3

175

S=148 I=32 E=1.26223e-11

XFF4834R

XFF4834R_chr30240 lcl|XFF4834R_chr32850947_3476585_r2_XFF4834R-XFF4834R_chr30240

19

172

S=110 I=30 E=5.39553e-07

XFF4834R

XFF4834R_chr42360 lcl|XFF4834R_chr_4920004_4920624_f1_XFF4834R-XFF4834R_chr42360

7

82

S=102 I=35 E=3.83705e-06

XFF4834R

XFF4834R_chr30370 lcl|XFF4834R_chr32980207_3488842_r3_XFF4834R-XFF4834R_chr30370

7

107

S=194 I=44 E=2.75622e-17

predicted enzyme

XFF4834R

XFF4834R_chr10130 lcl|gst-XFF4834R_chr10130

3

170

S=166 I=30 E=7.89573e-14

glutathionine S-transferase

XFF4834R

XFF4834R_chr24050 lcl|XFF4834R_chr26240973_2773731_r1_XFF4834R-XFF4834R_chr24050

3

175

S=148 I=32 E=1.26223e-11

X.species

YP_363079.1 lcl|gst3-XCV1348

1

218

S=999 I=88 E=3.6067e-114

glutathione transferase

X.species

NP_641634.1 lcl|gstA-XAC1299

6

218

S=977 I=89 E=1.76006e-111

glutathione S-transferase

X.species

NP_642775.1 lcl|gstA-XAC2460

5

173

S=269 I=38 E=9.13361e-26

glutathione S-transferase

X.species

YP_364368.1 lcl|gst-XCV2637

5

173

S=262 I=37 E=6.96463e-25

putative glutathione transferase

X.species

NP_637681.1 lcl|gstA-XCC2327

4

173

S=257 I=38 E=2.81021e-24

glutathione S-transferase

X.species

NP_636791.1 lcl|gst-XCC1418

6

107

S=219 I=48 E=1.03577e-19

glutathione S-transferase

X.species

lcl|gst-XALc_0548

7

102

S=197 I=49 E=5.41969e-17

probable glutathione transferase protein

X.species

YP_363249.1 lcl|gst4-XCV1518

7

107

S=194 I=44 E=1.27366e-16

glutathione transferase

X.species

NP_641795.1 lcl|gst-XAC1461

7

107

S=192 I=43 E=2.05736e-16

glutathione S-transferase

X.species

YP_362766.1 lcl|gst2-XCV1035

7

170

S=174 I=29 E=3.34679e-14

glutathione transferase

X.species

NP_641354.1 lcl|gst-XAC1007

7

170

S=167 I=31 E=2.46455e-13

glutathione S-transferase

X.species

NP_636315.1 lcl|gst-XCC0929

7

170

S=165 I=29 E=4.23157e-13

glutathione S-transferase

X.species

NP_642710.1 lcl|gstA-XAC2394

6

175

S=144 I=32 E=1.1514e-10

glutathione S-transferase

X.species

YP_364322.1 lcl|gst6-XCV2591

6

175

S=144 I=32 E=1.46976e-10

glutathione transferase

X.species

lcl|XALc_1105

6

104

S=134 I=37 E=2.09957e-09

hypothetical glutathione s-transferase protein

X.species

NP_642547.1 lcl|gst-XAC2230

7

161

S=130 I=30 E=7.43317e-09

glutathione S-transferase

X.species

NP_637641.1 lcl|gstA-XCC2286

6

175

S=125 I=30 E=3.02553e-08

glutathione S-transferase

X.species

NP_641808.2 lcl|gst-XAC1474

19

172

S=124 I=32 E=3.99917e-08

glutathione S-transferase

X.species

YP_363263.1 lcl|gst5-XCV1532

19

166

S=114 I=33 E=6.23331e-07

glutathione transferase

X.species

NP_636804.1 lcl|gst-XCC1431

19

166

S=112 I=33 E=1.03356e-06

glutathione S-transferase

X.species

NP_644646.1 lcl|gst-XAC4352

7

82

S=106 I=35 E=5.4646e-06

glutathione S-transferase

X.species

YP_366195.1 lcl|gst8-XCV4464

7

75

S=104 I=36 E=8.09004e-06

putative glutathione transferase

X.species

NP_639111.1 lcl|gst-XCC3766

13

99

S=102 I=42 E=1.62507e-05

glutathione S-transferase

X.species

YP_365462.1 lcl|XCV3731

37

91

S=99 I=44 E=3.62435e-05

maleylacetoacetate isomerase

pubmed

21

177

S=192 I=36 E=7.37595e-15

Glutathione S-transferase, C-terminal domain Glutathione-S-transferase-like protein

Pubmed 16461653

 

prodomImg

pubmed

6

175

S=191 I=32 E=1.07309e-14

Glutathione S-transferase GstA

Pubmed 9748456,10781092

 

prodomImg

pubmed

22

170

S=191 I=37 E=1.07309e-14

Putative glutathione S-transferase

Pubmed 12565867

 

prodomImg

pubmed

5

174

S=185 I=34 E=5.77342e-14

Putative glutathione S-transferase

Pubmed 12169590

 

prodomImg

pubmed

22

170

S=184 I=36 E=6.08348e-14

Glutathione S-transferase

Pubmed 9251217

 

prodomImg

pubmed

7

177

S=181 I=34 E=1.6294e-13

Glutathione-S-transferase-like protein ; Plasmid

Pubmed 9573207,11133965

 

prodomImg

pubmed

22

178

S=175 I=34 E=9.39972e-13

Glutathione S-transferase EC=2.5.1.18

Pubmed 10537204

 

prodomImg

pubmed

22

177

S=174 I=35 E=1.062e-12

Glutathione S-transferase

Pubmed 19187202

 

prodomImg

pubmed

22

178

S=174 I=34 E=1.11904e-12

Glutathione S-transferase

Pubmed 9190809,10900199

 

prodomImg

pubmed

22

178

S=174 I=34 E=1.12884e-12

Glutathione S-transferase EC=2.5.1.18

Pubmed 10537204

 

prodomImg

sp

7

106

S=169 I=43 E=2.8354e-12

Glutathione S-transferase GST-6.0 EC=2.5.1.18 ; Cytoplasm

 

prodomImg

sp

7

170

S=165 I=29 E=1.04855e-11

Glutathione S-transferase GST-4.5 EC=2.5.1.18 ; Cytoplasm

 

prodomImg

sp

22

98

S=139 I=41 E=1.49537e-08

Protein ligF ; Lignin degradation

 

prodomImg

sp

21

164

S=138 I=34 E=1.87585e-08

Glutathione S-transferase EC=2.5.1.18 ; Cytoplasm

 

prodomImg

sp

7

106

S=136 I=37 E=3.24898e-08

Protein gstA ; Transferase

 

prodomImg

Iprscan IPR012335 [G3DSA:3.40.30.10]

5

96

Thioredoxin fold

Iprscan IPR010987 [G3DSA:1.20.1050.10]

130

190

Glutathione S-transferase, C-terminal-like

Iprscan [PTHR11260:SF8]

5

194

-

Iprscan [PTHR11260]

5

194

-

Iprscan IPR004045 [PF02798]

5

76

Glutathione S-transferase, N-terminal

Iprscan IPR004046 [PF00043]

132

188

Glutathione S-transferase, C-terminal

Iprscan IPR004045 [PS50404]

2

82

Glutathione S-transferase, N-terminal

Iprscan IPR017933 [PS50405]

63

209

Glutathione S-transferase/chloride channel, C-terminal

Iprscan [seg]

179

195

-

PD749652

6

40

S=151 I=77 E=7.06131e-11

PD973776

75

140

S=130 I=41 E=2.49576e-08

PD869207

94

136

S=116 I=59 E=1.42607e-06

PD979055

196

218

S=106 I=91 E=2.14657e-05

PDA7Y8N7

3

76

S=106 I=34 E=2.30164e-05

PDA3U613

5

29

S=104 I=72 E=4.27444e-05

Iprscan IPR012336 [SSF52833]

5

86

Thioredoxin-like fold

Iprscan IPR010987 [SSF47616]

81

200

Glutathione S-transferase, C-terminal-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gE24ZH66)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

56 hits
swiss-prot

Swiss-Prot ncbi-blastp

14 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

6 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJFDtMc/XFF4834R_chr32370.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJFDtMc/XFF4834R_chr32370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJFDtMc/XFF4834R_chr32370.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJFDtMc/XFF4834R_chr32370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.