Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr31980XFF4834R_chr31980XFF4834R_chr31980putative beta-galactosidase

XFF4834R_chr31980 XFF4834R_chr31980
XFF4834R_chr31970
XFF4834R_chr31970
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31990
XFF4834R_chr31990
ID XFF4834R_chr31980
AC XFF4834R_chr31980
LT XFF4834R_chr31980
OR XFF4834R_chr from 3672105 to 3674669 on strand +
DE putative beta-galactosidase
IP Glycoside hydrolase, family 2; Galactose-binding domain-like; Glycoside hydrolase, family 2/20, immunoglobulin-like beta-sandwich domain; Glycoside hydrolase, catalytic core; Twin arginine translocation signal, Tat
CL 1.2.4 Polysaccharides GO:0000272
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: cation binding (GO:0043169)
Molecular Function: catalytic activity (GO:0003824)
hydrolyzing O-glycosyl compounds (GO:0004553)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110105)
MW 93059.9 Da
SQ 854 aa
 
........10........20........30........40........50
| | | | |
MSGINRRELLRGMLASGVSAALPVGAAGTVASAGAAAAPAAKNSVSTSAL
GDAALAPRERLLFDFGWRFHLGHASDAARDFEFGTFQRTFAKAGKDTATA
AQLAFDDSAWQQVDLPHDWAVGLPFRQEPISASITEEDPAAAHGYKPLGT
SFPENSVGWYRRRLQIPASDLGKRISLVFDGVFRECIVFCNGHIVGRHAS
GYCGFEVDLSEVLDYGKPNIIAIRVDGTLGEGWFYEGAGIYRHVWLQKTD
PLHLPQDGVFVRSTVRDGNTTAQLSTEVRNDGTAPRQCVVQARITAPDGR
IVAQAASAPVIVAPGQLQVVEQTLPLGQAALWSIDTPQLYSLTSSLHTDG
TAVDALVTPFGVRSIAFDAQRGFLLNGAPLKLHGTNNHQDHAGVGTAIPD
ALHAWRLRQLKSMGCNAYRSSHNPATPALLALCDQLGMLVIEETRRMSTD
PEAMGELDAMVRRGRNHPSVILWSLGNEEPQQVTARGARIVSRMQQRVRQ
LDPTRPTTFAMDKGFGDGVGQVVDVVGFNYRTSQMDGFHAQYPNIPIYGS
ETGSTVSVRGNYQRDDQRGYTRAYDLDHPWWASTAEAWWSYVAQRPYIAG
GFIWTGFDYRGEPTPYNRWPNVASQFGVLDSCGFPKDNYWYYRAQWTSEP
VLHLFPHWNWDGVLQPDDNGRIAVWCHSNLEAVELLVNGVSQGLQQVPAY
GHVEWRVVYAPGMIEARGYRGGKLVLSERRETTGKPAAIRLSCDRNTLRA
DAEDVAVVKVEILDAQGRLVPTADNLVQFALRGPAGLIGVGNGDPSSHED
DKAPRRKAFNGLCAALLQTTRSSGEIVLQATAPGLTSSTLRLPAEPTRSR
ASVA
XFF4834R

XFF4834R_chr07170 lcl|XFF4834R_chr07490900_0824794_f2_XFF4834R-XFF4834R_chr07170

51

842

S=1344 I=40 E=7.13025e-156

XFF4834R

XFF4834R_chr41230 lcl|uidA-XFF4834R_chr41230

102

842

S=1016 I=35 E=4.45936e-116

beta-D-glucuronidase

XFF4834R

XFF4834R_chr13290 lcl|XFF4834R_chr14140724_1525191_f1_XFF4834R-XFF4834R_chr13290

159

339

S=132 I=30 E=4.94048e-09

X.species

NP_641643.1 lcl|bga-XAC1308

1

854

S=4087 I=90 E=0

beta-galactosidase

X.species

YP_363090.1 lcl|XCV1359

1

854

S=4062 I=89 E=0

putative beta-galactosidase precursor

X.species

NP_636630.1 lcl|bga-XCC1256

1

853

S=3790 I=84 E=0

beta-galactosidase

X.species

NP_639455.2 lcl|XCC4116

102

845

S=1049 I=36 E=1.54806e-119

beta-galactosidase

X.species

YP_366087.1 lcl|bga2-XCV4356

87

842

S=1022 I=35 E=2.96953e-116

beta-galactosidase

X.species

NP_644549.2 lcl|XAC4250-XAC4250

97

842

S=1005 I=35 E=2.96457e-114

beta-galactosidase

X.species

NP_641061.1 lcl|lacZ-XAC0708

397

842

S=888 I=43 E=4.30022e-100

truncated beta-galactosidase

X.species

NP_641060.1 lcl|lacZ-XAC0707

51

318

S=299 I=34 E=1.00355e-28

truncated beta-galactosidase

X.species

NP_638508.2 lcl|XCC3162

159

285

S=129 I=34 E=4.19608e-08

glycosyl hydrolase

X.species

NP_643619.2 lcl|XAC3312-XAC3312

159

269

S=124 I=33 E=1.87985e-07

glycosyl hydrolase

X.species

YP_365161.1 lcl|XCV3430

159

269

S=122 I=32 E=3.37147e-07

putative O-glycosyl hydrolase

pubmed

1

853

S=3790 I=84 E=0

Beta-galactosidase Beta-galactosidase Gal02I EC=3.2.1.23 ; Glycosidase Hydrolase

Pubmed 15153767

 

prodomImg

pubmed

102

845

S=1051 I=36 E=3.55852e-118

Beta-galactosidase Gal02II EC=3.2.1.23 ; Glycosidase Hydrolase

Pubmed 15153767

 

prodomImg

pubmed

79

842

S=976 I=32 E=5.22876e-109

Beta-galactosidase ; Cell wall Glycosidase Hydrolase Peptidoglycan-anchor

Pubmed 11004197

 

prodomImg

pubmed

96

447

S=535 I=35 E=1.10598e-55

Beta-galactosidase BbgIII EC=3.2.1.23 ; Glycosidase Hydrolase

Pubmed 17684740

 

prodomImg

pubmed

456

685

S=329 I=32 E=1.12157e-30

Beta-galactosidase BbgIII EC=3.2.1.23 ; Glycosidase Hydrolase

Pubmed 17684740

 

prodomImg

sp

157

507

S=411 I=29 E=8.9313e-41

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase

 

prodomImg

sp

105

509

S=360 I=30 E=1.24857e-34

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase Magnesium Metal-binding Sodium

 

prodomImg

sp

96

509

S=348 I=29 E=4.11908e-33

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase Magnesium Metal-binding Sodium

 

prodomImg

sp

154

509

S=345 I=32 E=8.94952e-33

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase Magnesium Metal-binding Sodium

 

prodomImg

sp

104

501

S=343 I=29 E=1.48394e-32

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase

 

prodomImg

Iprscan IPR006101 [PR00132]

375

389

Glycoside hydrolase, family 2

Iprscan IPR006101 [PR00132]

464

479

Glycoside hydrolase, family 2

Iprscan [G3DSA:2.60.120.260]

57

250

-

Iprscan IPR013812 [G3DSA:2.60.40.320]

259

363

Glycoside hydrolase, family 2/20, immunoglobulin-like beta-sandwich domain

Iprscan IPR013781 [G3DSA:3.20.20.80]

366

648

Glycoside hydrolase, subgroup, catalytic core

Iprscan [PTHR10066:SF6]

383

783

-

Iprscan [PTHR10066]

383

783

-

Iprscan IPR006104 [PF02837]

58

250

Glycoside hydrolase family 2, carbohydrate-binding

Iprscan IPR006103 [PF02836]

371

532

Glycoside hydrolase family 2, TIM barrel

Iprscan IPR006102 [PF00703]

258

363

Glycoside hydrolase family 2, immunoglobulin-like beta-sandwich

Iprscan IPR006311 [TIGR01409]

4

26

Twin-arginine translocation pathway, signal sequence

Iprscan IPR017909 [PS51318]

1

33

Twin arginine translocation signal, Tat

Iprscan [seg]

24

46

-

Iprscan [seg]

514

528

-

Iprscan [seg]

750

761

-

Iprscan [SignalP-NN(euk)]

1

28

-

PD340433

657

853

S=415 I=43 E=1.27248e-42

PD881969

511

588

S=329 I=81 E=2.76574e-32

PD736581

589

656

S=244 I=57 E=6.17063e-22

PD388613

63

125

S=167 I=54 E=1.46459e-12

PD624282

1

62

S=165 I=61 E=2.14942e-12

PD979230

249

322

S=143 I=49 E=1.01296e-09

PDA1X5B9

134

159

S=135 I=96 E=1.00333e-08

PDA1N8L2

535

691

S=125 I=29 E=1.39627e-07

PDA1F7A5

407

452

S=124 I=48 E=2.10347e-07

PD339503

160

246

S=123 I=40 E=2.9297e-07

Iprscan IPR017853 [SSF51445]

366

648

Glycoside hydrolase, catalytic core

Iprscan IPR008979 [SSF49785]

44

251

Galactose-binding domain-like

Iprscan IPR006102 [SSF49303]

254

363

Glycoside hydrolase family 2, immunoglobulin-like beta-sandwich

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 8XeXpx6A)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

99 hits
swiss-prot

Swiss-Prot ncbi-blastp

80 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw5bLUq/XFF4834R_chr31980.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw5bLUq/XFF4834R_chr31980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw5bLUq/XFF4834R_chr31980.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBw5bLUq/XFF4834R_chr31980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.