Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr31850XFF4834R_chr34410981_3656274_r1_XFF4834R-XFF4834R_chr31850XFF4834R_chr31850putative isrso12-like transposase orfa protein

XFF4834R_chr34410981_3656274_r1_XFF4834R-XFF4834R_chr31850 XFF4834R_chr31850
XFF4834R_chr_3368
XFF4834R_chr_3368
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31870
XFF4834R_chr31870
ID XFF4834R_chr34410981_3656274_r1_XFF4834R-XFF4834R_chr31850
AC XFF4834R_chr31850
LT XFF4834R_chr31850
OR XFF4834R_chr from 3655981 to 3656274 on strand -
DE putative isrso12-like transposase orfa protein
IP Transposase IS3/IS911
CL 8.3.1 transposases GO:0004803
EC
GO InterPro
DNA-mediated (GO:0006313)
Molecular Function: transposase activity (GO:0004803)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN orfb of the transposase is disrupted, it corresponds to the pseudogene XFF4834R_chr31840
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20121001)
MW 11015.6 Da
SQ 97 aa
 
........10........20........30........40........50
| | | | |
MGSGCHEELSDEKLTFHRGADAYALKQAELGMAVGDIFQKMGIAEARFYV
WRKKYGGLGPSEFKRLRLRDQEDRQLEQLVAEASLNKATLQEIVKKL
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr23850 lcl|XFF4834R_chr26040065_2752331_r2_XFF4834R-XFF4834R_chr23850

24

96

S=125 I=34 E=1.80095e-09

XFF4834R

XFF4834R_chr19620 lcl|XFF4834R_chr21100761_2255027_r2_XFF4834R-XFF4834R_chr19620

24

96

S=117 I=33 E=1.92943e-08

XFF4834R

XFF4834R_plc_0033 lcl|XFF4834R_plc_0028367_0028633_r1_XFF4834R-XFF4834R_plc_0033

25

96

S=100 I=33 E=1.94308e-06

XFF4834R

XFF4834R_chr15790 lcl|XFF4834R_chr17010041_1824307_r3_XFF4834R-XFF4834R_chr15790

25

96

S=97 I=33 E=4.14875e-06

XFF4834R

XFF4834R_chr15550 lcl|XFF4834R_chr16760670_1795936_f2_XFF4834R-XFF4834R_chr15550

25

96

S=97 I=33 E=4.14875e-06

XFF4834R

XFF4834R_chr05830 lcl|XFF4834R_chr_0658360_0658626_r1_XFF4834R-XFF4834R_chr05830

25

96

S=97 I=33 E=4.14875e-06

XFF4834R

XFF4834R_chr25050 lcl|XFF4834R_chr_2898230_2898496_r3_XFF4834R-XFF4834R_chr25050

25

96

S=97 I=33 E=4.52671e-06

XFF4834R

XFF4834R_chr15000 lcl|XFF4834R_chr16060824_1720090_r3_XFF4834R-XFF4834R_chr15000

25

96

S=97 I=33 E=4.52671e-06

XFF4834R

XFF4834R_chr_3386 lcl|XFF4834R_chr34600896_3678162_f1_XFF4834R-XFF4834R_chr_3386

25

96

S=95 I=28 E=8.40667e-06

XFF4834R

XFF4834R_plc00450 lcl|XFF4834R_plc_0038060_0038326_r1_XFF4834R-XFF4834R_plc00450

25

96

S=94 I=33 E=1.07312e-05

X.species

lcl|XALc_1470

1

96

S=241 I=54 E=5.09027e-23

putative isrso12 transposase orf a protein

X.species

YP_362169.1 lcl|XCV0438

16

96

S=232 I=59 E=6.96133e-22

putative ISRSO12 transposase (fragment)

X.species

lcl|XALc_2106

1

94

S=188 I=46 E=1.49311e-16

putative isrso12 transposase orf a (fragment) protein

X.species

NP_642688.1 lcl|XAC2372-XAC2372

24

96

S=119 I=33 E=3.13927e-08

IS1479 transposase

X.species

NP_643810.1 lcl|XAC3503-XAC3503

24

96

S=119 I=33 E=3.16676e-08

ISxac4 transposase

X.species

NP_642916.1 lcl|XAC2603-XAC2603

24

96

S=119 I=33 E=3.57789e-08

ISxac4 transposase

X.species

lcl|XALc_2270

24

96

S=112 I=32 E=2.21313e-07

putative isxcc1 transposase orfa protein

X.species

YP_365093.1 lcl|XCV3362

24

96

S=108 I=29 E=6.87467e-07

ISxcc1 transposase

X.species

YP_363582.1 lcl|XCV1851

24

96

S=108 I=29 E=6.87467e-07

ISxcc1 transposase

X.species

YP_363578.1 lcl|XCV1847

24

96

S=108 I=29 E=6.87467e-07

ISxcc1 transposase

pubmed

16

96

S=232 I=59 E=2.25928e-20

Putative truncated transposase

Pubmed 8664494,11844763

 

prodomImg

pubmed

22

96

S=167 I=43 E=1.62543e-12

Putative IS1617 transposase Putative transposase ; Plasmid

Pubmed 9748454,9746557

 

prodomImg

pubmed

16

96

S=139 I=35 E=3.43177e-09

Putative transposase A

Pubmed 11150670

 

prodomImg

pubmed

25

91

S=117 I=37 E=1.73414e-06

OrfA

Pubmed 15126494

 

prodomImg

pubmed

25

91

S=117 I=37 E=1.87569e-06

ORF A protein

Pubmed 7737514,8825375

 

prodomImg

pubmed

25

91

S=117 I=37 E=1.87569e-06

Transposase

Pubmed 12620628,7737514

 

prodomImg

pubmed

25

95

S=115 I=37 E=3.4834e-06

Insertion element IS407 uncharacterized 10.0 kDa protein ; Transposable

Pubmed 1718819

 

prodomImg

pubmed

25

91

S=113 I=36 E=5.11223e-06

OrfA ; Plasmid

Pubmed 12118887

 

prodomImg

pubmed

25

95

S=113 I=37 E=5.38678e-06

IS407A, transposase OrfA TnpA

Pubmed 11373120

 

prodomImg

pubmed

24

96

S=112 I=29 E=7.12028e-06

Transposase

Pubmed 17488332

 

prodomImg

Iprscan IPR002514 [PF01527]

24

90

Transposase IS3/IS911

Iprscan [seg]

65

79

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one fshJ6RQe)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

17 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

11 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1ESeTY/XFF4834R_chr31850.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1ESeTY/XFF4834R_chr31850.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1ESeTY/XFF4834R_chr31850.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB1ESeTY/XFF4834R_chr31850.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.