Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr31820rpoE5XFF4834R_chr31820RNA polymerase, sigma-24 RpoE

rpoE5 XFF4834R_chr31820
XFF4834R_chr31810
XFF4834R_chr31810
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31830
XFF4834R_chr31830
ID rpoE5
AC XFF4834R_chr31820
LT XFF4834R_chr31820
OR XFF4834R_chr from 3652364 to 3652984 on strand -
DE RNA polymerase, sigma-24 RpoE
IP RNA polymerase sigma-70 RpoE type; RNA polymerase sigma-W, bacillaceae
CL 3.1.2.1 Sigma factors, anti-sigmafactors GO:0016987 GO:0016989
EC
GO InterPro
Biological Process: transcription initiation (GO:0006352)
DNA-dependent (GO:0006355)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: transcription factor activity (GO:0003700)
Molecular Function: sigma factor activity (GO:0016987)

Curated
PM
AN orthologous to rpoE of Ecoli (and other Xanthomonas)
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: validated by darrasse (20120316)
MW 23948.7 Da
SQ 206 aa
 
........10........20........30........40........50
| | | | |
MAEVDTPQELDLELVRRVQRGESAAFDVLVRKYQHRIVALIGRYIADWSE
CQDVAQDTFVRAYRAITSFRGDAQFYTWLHRIAVNTAKNHLVAHNRRPPT
DDIEISDAEQFDGATRLRDTDTPERELMRQELEQTVMRAVQALPEELRSA
ITLREVEGLSYEDIARKMDCPIGTVRSRIFRAREAIDIELRPLLETESAT
RERHRV
XFF4834R

XFF4834R_chr31200 lcl|XFF4834R_chr_3589176_3589739_f3_XFF4834R-XFF4834R_chr31200

21

182

S=151 I=30 E=4.53141e-12

XFF4834R

XFF4834R_chr28290 lcl|XFF4834R_chr30830900_3260493_f1_XFF4834R-XFF4834R_chr28290

1

183

S=142 I=29 E=5.533e-11

XFF4834R

XFF4834R_chr39990 lcl|fecI-XFF4834R_chr39990

50

185

S=102 I=28 E=3.88765e-06

KpLE2 phage-like element; RNA polymerase, sigma 19 factor

XFF4834R

XFF4834R_chr09290 lcl|XFF4834R_chr09880250_1069813_r3_XFF4834R-XFF4834R_chr09290

123

194

S=97 I=33 E=1.61023e-05

X.species

NP_636641.1 lcl|algU-XCC1267

1

206

S=1057 I=98 E=2.9434e-121

RNA polymerase sigma factor RpoE

X.species

YP_363101.1 lcl|rpoE2-XCV1370

1

206

S=1047 I=98 E=4.27864e-120

RNA polymerase sigma factor RpoE

X.species

NP_641654.1 lcl|algU-XAC1319

1

206

S=1047 I=98 E=4.27864e-120

RNA polymerase sigma factor RpoE

X.species

lcl|rpoE1-XALc_2547

1

206

S=920 I=83 E=1.15163e-104

probable rna polymerase sigma-e factor protein

X.species

NP_636680.1 lcl|algU-XCC1306

26

183

S=182 I=30 E=3.40911e-15

RNA polymerase sigma factor

X.species

YP_363167.1 lcl|rpoE3-XCV1436

21

182

S=151 I=30 E=1.66225e-11

RNA polymerase sigma factor

X.species

NP_641715.1 lcl|rpoE-XAC1380

21

182

S=151 I=30 E=1.66225e-11

RNA polymerase sigma factor

X.species

NP_637035.1 lcl|rpoE-XCC1665

1

183

S=147 I=29 E=4.69128e-11

RNA polymerase sigma-E factor

X.species

YP_363449.1 lcl|rpoE4-XCV1718

1

183

S=144 I=29 E=1.22407e-10

RNA polymerase ECF-type sigma factor

X.species

NP_636708.1 lcl|rpoE-XCC1334

21

182

S=144 I=29 E=1.25651e-10

RNA polymerase sigma factor

pubmed

1

206

S=1057 I=98 E=1.04067e-119

RNA polymerase sigma-H factor RNA polymerase sigmaE subunit ; DNA-binding Transcription regulation

Pubmed 19054112

 

prodomImg

pubmed

8

195

S=640 I=63 E=3.6273e-69

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 8606151

 

prodomImg

pubmed

8

194

S=638 I=63 E=5.27719e-69

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 17470813,18599839

 

prodomImg

pubmed

8

194

S=638 I=63 E=5.27719e-69

RNA polymerase sigma-H factor ; Alginate biosynthesis DNA-binding Transcription regulation

Pubmed 8432708,8378309

 

prodomImg

pubmed

8

195

S=634 I=62 E=1.69744e-68

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 11722923

 

prodomImg

pubmed

8

195

S=633 I=62 E=2.40577e-68

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 10572118,11761711

 

prodomImg

pubmed

13

191

S=606 I=62 E=4.53505e-65

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 18080141

 

prodomImg

pubmed

8

195

S=587 I=55 E=8.33512e-63

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 12207701

 

prodomImg

pubmed

8

201

S=587 I=58 E=8.33512e-63

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 16604122

 

prodomImg

pubmed

8

195

S=583 I=52 E=2.7282e-62

RNA polymerase sigma factor ; DNA-binding Transcription regulation

Pubmed 8801425

 

prodomImg

Iprscan [G3DSA:1.10.1740.10]

13

99

-

Iprscan IPR007627 [PF04542]

29

97

RNA polymerase sigma-70 region 2

Iprscan IPR013249 [PF08281]

133

186

RNA polymerase sigma factor 70, region 4 type 2

Iprscan IPR014286 [TIGR02939]

5

194

RNA polymerase sigma-70 RpoE type

Iprscan IPR014284 [TIGR02937]

24

190

RNA polymerase sigma-70

PD350580

6

75

S=139 I=41 E=2.04107e-09

PD340420

143

186

S=131 I=57 E=2.03936e-08

PD759964

69

140

S=126 I=48 E=8.08653e-08

PDA33057

72

142

S=114 I=37 E=2.59891e-06

PDA1E9G0

119

186

S=107 I=38 E=1.539e-05

PDA4Y514

7

91

S=106 I=28 E=2.10646e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one KDy6GkEf)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

64 hits
swiss-prot

Swiss-Prot ncbi-blastp

20 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBajzajX/XFF4834R_chr31820.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBajzajX/XFF4834R_chr31820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBajzajX/XFF4834R_chr31820.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBajzajX/XFF4834R_chr31820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.