Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr31810rseAXFF4834R_chr31810putative anti-RNA polymerase sigma factor RseA

rseA XFF4834R_chr31810
XFF4834R_chr31800
XFF4834R_chr31800
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31820
XFF4834R_chr31820
ID rseA
AC XFF4834R_chr31810
LT XFF4834R_chr31810
OR XFF4834R_chr from 3651474 to 3652367 on strand -
DE putative anti-RNA polymerase sigma factor RseA
IP Anti sigma-E protein RseA, N-terminal
CL 3.1.2.1 Sigma factors, anti-sigmafactors GO:0016987 GO:0016989
EC
GO InterPro
Molecular Function: protein binding (GO:0005515)
Molecular Function: sigma factor antagonist activity (GO:0016989)

Curated
PM
AN Anti sigma-E protein RseA, N-terminal domain Sigma-E is important for the induction of proteins involved in heat shock response. RseA binds sigma-E via its N-terminal domain, sequestering sigma-E and preventing transcription from heat-shock promoters. The C-terminal domain is located in the periplasm, and may interact with other protein that signal periplasmic stress. a transmembrane domain is detected in this protein by interproscan. Functional study in Xcc.
CC COG: [T] Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20121121)
MW 30552.8 Da
SQ 297 aa
 
........10........20........30........40........50
| | | | |
MSHNPAMSTTDKFELHYRQQLSALVDGELSADESRFLLRRLAHDEELAGC
HERWQLCGDVLRGAASAPAPLDFAARVRGAIAEEPAPQAQPAARPGARWR
WGGGAAIAASVAAIAMFLARERLPDAAAPGAETPVYATAAQLPPASQTPQ
VPAGPKAPAAPAPGTPDEVAALAAAVPAAALASTRRGAATRNQQVARSAA
ARQQQAPTRMVAAAVPAPTETSSAVAATPSNPFTHPDTTLQARPWPRAAL
SGAGESPLNASFRQSRPGTAFYPFEPAPQAVASPAPNRPAPAPAPQD
X.species

YP_363102.1 lcl|XCV1371

1

279

S=748 I=59 E=1.39801e-83

putative negative regulator of sigma E activity

X.species

NP_641655.1 lcl|XAC1320-XAC1320

1

279

S=717 I=59 E=8.47674e-80

regulatory protein

X.species

NP_636642.1 lcl|XCC1268

1

275

S=508 I=46 E=1.75712e-54

regulatory protein

X.species

lcl|XALc_2546

11

78

S=279 I=72 E=8.03935e-27

putative regulatory protein

X.species

lcl|XALc_2546

230

276

S=102 I=51 E=2.72451e-05

putative regulatory protein

pubmed

7

275

S=489 I=46 E=1.04785e-50

Anti-sigma factor RseA

Pubmed 19054112

 

prodomImg

Iprscan IPR005572 [PF03872]

19

92

Anti sigma-E protein RseA, N-terminal

Iprscan [seg]

64

75

-

Iprscan [seg]

79

115

-

Iprscan [seg]

152

164

-

Iprscan [seg]

169

191

-

Iprscan [seg]

193

206

-

Iprscan [seg]

280

295

-

PD690204

231

279

S=186 I=73 E=5.65626e-15

PD015937

7

63

S=166 I=60 E=1.27042e-12

PD604199

116

150

S=110 I=67 E=7.35608e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one r59wjYBi)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqkinmI/XFF4834R_chr31810.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqkinmI/XFF4834R_chr31810.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqkinmI/XFF4834R_chr31810.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqkinmI/XFF4834R_chr31810.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.