Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr31800mucDXFF4834R_chr31800probable periplasmic serine protease

mucD XFF4834R_chr31800
XFF4834R_chr31790
XFF4834R_chr31790
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31810
XFF4834R_chr31810
ID mucD
AC XFF4834R_chr31800
LT XFF4834R_chr31800
OR XFF4834R_chr from 3649787 to 3651364 on strand -
DE probable periplasmic serine protease
IP Peptidase S1C, HrtA/DegP2/Q/S; Serine/cysteine peptidase, trypsin-like
CL 1.2.3 Proteins/peptides/glycopeptides GO:0006508 GO:0009050
EC
GO InterPro
Biological Process: proteolysis (GO:0006508)
Molecular Function: protein binding (GO:0005515)
Molecular Function: serine-type endopeptidase activity (GO:0004252)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100802)
MW 53808.9 Da
SQ 525 aa
 
........10........20........30........40........50
| | | | |
MNHRIRTQMFGLIAMTLPLAACAQQPAPAAKDVAPIAANRSATPAPQLVA
GLPDFTNLVEQVGPGVVNIETTITRKDAMARQQRSGPGGRGGGAMPDDDQ
MPEFFRRFFGPDFQMPGGPRQGPGGGDDDGGIAGKSMGSGFIISADGYVL
TNHHVVDGASEVTVKLTDRREFKAKVVGSDEQYDVALLKIEAKGLPTVRL
GDSNTLKPGQWVVAIGSPFGLDHSVTAGIVSATGRSNPYADQRYVPFIQT
DVAINQGNSGGPLLNTRGEVVGINSQIFSASGGYMGISFAIPIDLAFSAA
EQIKATGHVSRGMLGVAVGPIDSLKAQGLGLPDSRGALVNDIPAGSPAAK
AGIEVGDVIRAVNGKSIDVASDLPPMIGLMAPGTKVTLDVLRDGKPRTVT
VTLAPLQDGTGNAAPRTAAEEAKPGAPASVELLGLQVADLTAAERSRLGL
EAGEGVRIAAVIGAAARSTQPPLSPGLVIARVGRTKVGSVAELNRALSSY
KKGDVVMLLVTDGKATSYVALKAGG
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr38450 lcl|degP-XFF4834R_chr38450

135

403

S=582 I=48 E=9.13091e-64

serine endoprotease (protease Do), membrane-associated

XFF4834R

XFF4834R_chr00240 lcl|XFF4834R_chr00190747_0026270_r2_XFF4834R-XFF4834R_chr00240

346

403

S=121 I=47 E=6.53506e-08

X.species

NP_641656.1 lcl|mucD-XAC1321

1

525

S=2343 I=88 E=0

periplasmic protease

X.species

YP_363103.1 lcl|mucD-XCV1372

1

525

S=2303 I=87 E=0

periplasmic serine protease MucD

X.species

NP_636643.1 lcl|mucD-XCC1269

1

525

S=2194 I=82 E=0

periplasmic protease

X.species

lcl|XALc_2545

48

525

S=1643 I=70 E=0

probable periplasmic protease protein

X.species

NP_644280.1 lcl|htrA-XAC3980

135

403

S=582 I=48 E=3.10756e-63

protease DO

X.species

NP_639238.1 lcl|htrA-XCC3898

135

410

S=582 I=49 E=3.4503e-63

protease Do

X.species

YP_365805.1 lcl|htrA-XCV4074

135

403

S=582 I=48 E=3.48052e-63

protease DO precursor

X.species

lcl|XALc_0434

135

403

S=567 I=50 E=2.53866e-61

probable periplasmic protease protein

X.species

YP_361755.1 lcl|ctp-XCV0024

346

403

S=121 I=47 E=2.62481e-07

periplasmic carboxyl-terminal protease

X.species

NP_640379.1 lcl|ctp-XAC0023

346

403

S=120 I=47 E=3.62409e-07

carboxyl-terminal protease

X.species

NP_635416.1 lcl|ctp-XCC0021

346

403

S=113 I=43 E=2.30111e-06

carboxyl-terminal protease

X.species

lcl|XALc_0393

319

402

S=104 I=38 E=2.57513e-05

putative periplasmic carboxyl-terminal protease precursor signal peptide protein

pubmed

39

525

S=2137 I=86 E=0

Protease MucD

Pubmed 19054112

 

prodomImg

pubmed

50

453

S=958 I=52 E=4.2876e-107

MucD

Pubmed 11555287

 

prodomImg

pubmed

50

453

S=958 I=52 E=4.51787e-107

MucD Serine protease MucD

Pubmed 8378309,7768826

 

prodomImg

pubmed

52

453

S=917 I=51 E=3.28705e-102

MucD

Pubmed 11761711

 

prodomImg

pubmed

138

523

S=681 I=43 E=1.59723e-73

Probable serine protease do-like EC=3.4.21.- ; Hydrolase Repeat Signal

Pubmed 2379836

 

prodomImg

sp

138

523

S=681 I=43 E=1.08629e-73

Probable serine protease do-like EC=3.4.21.- ; Hydrolase Repeat Signal

 

prodomImg

sp

55

523

S=679 I=40 E=1.63649e-73

Probable serine protease do-like EC=3.4.21.- ; Hydrolase Repeat Signal

 

prodomImg

sp

96

522

S=627 I=38 E=3.15872e-67

Probable serine protease do-like EC=3.4.21.- ; Hydrolase Repeat Signal

 

prodomImg

sp

96

403

S=616 I=43 E=7.22547e-66

Probable periplasmic serine protease do/hhoA-like EC=3.4.21.- ; Hydrolase Repeat Signal

 

prodomImg

sp

55

438

S=607 I=39 E=8.08589e-65

Probable periplasmic serine protease DO-like EC=3.4.21.- ; Hydrolase Repeat Signal

 

prodomImg

Iprscan IPR001940 [PR00834]

147

159

Peptidase S1C, HrtA/DegP2/Q/S

Iprscan IPR001940 [PR00834]

168

188

Peptidase S1C, HrtA/DegP2/Q/S

Iprscan IPR001940 [PR00834]

208

232

Peptidase S1C, HrtA/DegP2/Q/S

Iprscan IPR001940 [PR00834]

244

261

Peptidase S1C, HrtA/DegP2/Q/S

Iprscan IPR001940 [PR00834]

266

283

Peptidase S1C, HrtA/DegP2/Q/S

Iprscan IPR001940 [PR00834]

352

364

Peptidase S1C, HrtA/DegP2/Q/S

Iprscan [G3DSA:2.40.10.10]

50

200

-

Iprscan [G3DSA:2.40.10.10]

199

316

-

Iprscan [G3DSA:2.30.42.10]

330

402

-

Iprscan [G3DSA:2.30.42.10]

432

524

-

Iprscan [PTHR22939:SF10]

54

516

-

Iprscan [PTHR22939]

54

516

-

Iprscan IPR001254 [PF00089]

136

292

Peptidase S1/S6, chymotrypsin/Hap

Iprscan IPR001478 [PF00595]

311

390

PDZ/DHR/GLGF

Iprscan IPR001478 [SM00228]

312

394

PDZ/DHR/GLGF

Iprscan IPR001478 [SM00228]

431

514

PDZ/DHR/GLGF

Iprscan IPR011782 [TIGR02037]

53

521

Peptidase S1C, Do

Iprscan IPR001478 [PS50106]

310

394

PDZ/DHR/GLGF

Iprscan [seg]

17

38

-

Iprscan [seg]

86

93

-

Iprscan [seg]

116

131

-

Iprscan [seg]

455

467

-

Iprscan [SignalP-NN(euk)]

1

22

-

PD001071

334

403

S=199 I=56 E=1.6183e-16

PD009332

137

203

S=194 I=59 E=6.70285e-16

PD001397

206

275

S=185 I=55 E=7.43592e-15

PDA1R7S6

294

325

S=160 I=100 E=9.46823e-12

PDA1K4B8

490

525

S=143 I=78 E=1.0495e-09

PD387494

335

403

S=136 I=53 E=6.60593e-09

PDA7E5L2

403

430

S=135 I=100 E=9.12084e-09

PDA8V6P1

138

276

S=127 I=28 E=8.20794e-08

PDA1V4D3

422

489

S=115 I=44 E=2.43885e-06

PDA8O3A5

291

411

S=113 I=28 E=4.18743e-06

Iprscan IPR009003 [SSF50494]

51

308

Serine/cysteine peptidase, trypsin-like

Iprscan IPR001478 [SSF50156]

270

396

PDZ/DHR/GLGF

Iprscan IPR001478 [SSF50156]

429

524

PDZ/DHR/GLGF

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YjMIboOy)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

113 hits
swiss-prot

Swiss-Prot ncbi-blastp

93 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

26 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiSp8gx/XFF4834R_chr31800.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiSp8gx/XFF4834R_chr31800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiSp8gx/XFF4834R_chr31800.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiSp8gx/XFF4834R_chr31800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.