Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr30370gst4XFF4834R_chr30370probable glutathione transferase

gst4 XFF4834R_chr30370
XFF4834R_chr30360
XFF4834R_chr30360
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30380
XFF4834R_chr30380
ID gst4
AC XFF4834R_chr30370
LT XFF4834R_chr30370
OR XFF4834R_chr from 3488207 to 3488842 on strand -
DE probable glutathione transferase
IP Intracellular chloride channel; Glutathione S-transferase, N-terminal; Glutathione S-transferase, C-terminal-like; Glutathione S-transferase, predicted
CL 5.6 Protection GO:0006950
EC
GO InterPro


Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100521)
MW 23559.9 Da
SQ 211 aa
 
........10........20........30........40........50
| | | | |
MVATLYHSPSTAALVVHWLLIELDIPHALHPLDFERGEHKSPQYLALNPA
GVVPTLVLDGQVLTEAAAIVLQLADLHPQAGLAPAVGTPERAAYYKWMFF
CANTLQPAYRAWFYPSEPAGAGQAEAAQLHARRKLEAAWTQVDVHLQAHG
PYLLGKTVSAADFMLTMLMRWSRNMPRPTDTWPALRAHAMQMKARPAFQE
TYRREGLTDWT
XFF4834R

XFF4834R_chr10130 lcl|gst-XFF4834R_chr10130

5

207

S=208 I=31 E=6.29614e-19

glutathionine S-transferase

XFF4834R

XFF4834R_chr32370 lcl|XFF4834R_chr35050976_3725632_r3_XFF4834R-XFF4834R_chr32370

5

106

S=195 I=44 E=2.53836e-17

XFF4834R

XFF4834R_chr37110 lcl|XFF4834R_chr40290220_4294876_r3_XFF4834R-XFF4834R_chr37110

10

199

S=134 I=28 E=6.35892e-10

predicted glutathione S-transferase

XFF4834R

XFF4834R_chr42360 lcl|XFF4834R_chr_4920004_4920624_f1_XFF4834R-XFF4834R_chr42360

5

200

S=124 I=27 E=8.18144e-09

XFF4834R

XFF4834R_chr30240 lcl|XFF4834R_chr32850947_3476585_r2_XFF4834R-XFF4834R_chr30240

8

198

S=120 I=27 E=2.94745e-08

XFF4834R

XFF4834R_chr24050 lcl|XFF4834R_chr26240973_2773731_r1_XFF4834R-XFF4834R_chr24050

1

206

S=105 I=23 E=1.97034e-06

XFF4834R

XFF4834R_chr10130 lcl|gst-XFF4834R_chr10130

5

207

S=208 I=31 E=6.29614e-19

glutathionine S-transferase

XFF4834R

XFF4834R_chr32370 lcl|XFF4834R_chr35050976_3725632_r3_XFF4834R-XFF4834R_chr32370

5

106

S=195 I=44 E=2.53836e-17

X.species

YP_363249.1 lcl|gst4-XCV1518

1

211

S=1008 I=92 E=2.25984e-115

glutathione transferase

X.species

NP_641795.1 lcl|gst-XAC1461

5

211

S=992 I=92 E=1.94528e-113

glutathione S-transferase

X.species

NP_636791.1 lcl|gst-XCC1418

1

211

S=872 I=78 E=7.55764e-99

glutathione S-transferase

X.species

YP_364368.1 lcl|gst-XCV2637

4

197

S=254 I=35 E=6.5061e-24

putative glutathione transferase

X.species

NP_642775.1 lcl|gstA-XAC2460

4

197

S=252 I=35 E=9.54832e-24

glutathione S-transferase

X.species

NP_637681.1 lcl|gstA-XCC2327

4

171

S=237 I=36 E=6.27262e-22

glutathione S-transferase

X.species

NP_636315.1 lcl|gst-XCC0929

5

208

S=217 I=33 E=1.86225e-19

glutathione S-transferase

X.species

YP_362766.1 lcl|gst2-XCV1035

5

207

S=211 I=31 E=1.05573e-18

glutathione transferase

X.species

NP_641354.1 lcl|gst-XAC1007

5

207

S=207 I=31 E=2.70704e-18

glutathione S-transferase

X.species

lcl|gst-XALc_0548

5

208

S=201 I=33 E=1.74907e-17

probable glutathione transferase protein

X.species

YP_363079.1 lcl|gst3-XCV1348

5

197

S=196 I=36 E=6.63959e-17

glutathione transferase

X.species

NP_641634.1 lcl|gstA-XAC1299

5

106

S=196 I=44 E=6.81555e-17

glutathione S-transferase

X.species

NP_642547.1 lcl|gst-XAC2230

5

205

S=163 I=30 E=6.44661e-13

glutathione S-transferase

X.species

NP_636804.1 lcl|gst-XCC1431

8

198

S=130 I=28 E=5.49191e-09

glutathione S-transferase

X.species

NP_641808.2 lcl|gst-XAC1474

8

198

S=127 I=28 E=1.43298e-08

glutathione S-transferase

X.species

NP_639111.1 lcl|gst-XCC3766

10

200

S=124 I=28 E=2.95474e-08

glutathione S-transferase

X.species

NP_644125.1 lcl|gst-XAC3819

18

199

S=124 I=28 E=3.80476e-08

glutathione S-transferase

X.species

NP_644646.1 lcl|gst-XAC4352

5

208

S=123 I=28 E=3.83808e-08

glutathione S-transferase

X.species

YP_366195.1 lcl|gst8-XCV4464

5

171

S=117 I=28 E=2.08303e-07

putative glutathione transferase

X.species

YP_363263.1 lcl|gst5-XCV1532

8

198

S=116 I=28 E=3.05705e-07

glutathione transferase

X.species

YP_364322.1 lcl|gst6-XCV2591

4

206

S=105 I=23 E=7.49807e-06

glutathione transferase

X.species

NP_642710.1 lcl|gstA-XAC2394

4

206

S=104 I=23 E=9.73968e-06

glutathione S-transferase

X.species

lcl|XALc_1105

1

107

S=95 I=30 E=9.48031e-05

hypothetical glutathione s-transferase protein

pubmed

5

207

S=246 I=35 E=2.08277e-21

Glutathione S-transferase (BphK) EC=2.5.1.18 Glutathione S-transferase EC=2.5.1.18

Pubmed 8026764

 

prodomImg

pubmed

5

207

S=245 I=35 E=2.87569e-21

Glutathione S-transferase EC=2.5.1.18

Pubmed 8026764,12770715

 

prodomImg

pubmed

5

207

S=236 I=35 E=3.39097e-20

Glutathione S-transferase

Pubmed 9190809,10900199

 

prodomImg

pubmed

5

203

S=232 I=34 E=1.00841e-19

Glutathione S-transferase EC=2.5.1.18

Pubmed 10537204

 

prodomImg

pubmed

5

207

S=226 I=32 E=4.59715e-19

Putative gluthione S-transferase ; Plasmid

Pubmed 15288784

 

prodomImg

pubmed

5

207

S=226 I=32 E=4.59715e-19

Glutathione-S-transferase-like protein ; Plasmid

Pubmed 15246534

 

prodomImg

pubmed

5

207

S=226 I=32 E=4.59715e-19

Putative glutathione S-transferase

Pubmed 17096121

 

prodomImg

pubmed

5

207

S=226 I=32 E=4.59715e-19

Putative glutathione S-transferase ; Plasmid

Pubmed 10719200

 

prodomImg

pubmed

5

207

S=224 I=32 E=1.02529e-18

BphK ; Plasmid

Pubmed 16244860

 

prodomImg

pubmed

5

208

S=217 I=33 E=6.62459e-18

Glutathione S-transferase GST-4.5 EC=2.5.1.18 ; Cytoplasm

Pubmed 8342943

 

prodomImg

sp

5

208

S=217 I=33 E=4.58294e-18

Glutathione S-transferase GST-4.5 EC=2.5.1.18 ; Cytoplasm

 

prodomImg

sp

5

208

S=175 I=26 E=4.7672e-13

Glutathione S-transferase EC=2.5.1.18 ; Cytoplasm

 

prodomImg

sp

5

207

S=162 I=26 E=2.0429e-11

Glutathione S-transferase GST-6.0 EC=2.5.1.18 ; Cytoplasm

 

prodomImg

sp

14

207

S=137 I=23 E=2.11011e-08

Glutathione S-transferase EC=2.5.1.18 ; Cytoplasm

 

prodomImg

sp

5

204

S=132 I=28 E=9.12931e-08

Protein gstA ; Transferase

 

prodomImg

Iprscan IPR012335 [G3DSA:3.40.30.10]

6

81

Thioredoxin fold

Iprscan IPR010987 [G3DSA:1.20.1050.10]

83

208

Glutathione S-transferase, C-terminal-like

Iprscan [PTHR11260]

2

202

-

Iprscan IPR004045 [PF02798]

2

70

Glutathione S-transferase, N-terminal

Iprscan IPR004046 [PF00043]

109

196

Glutathione S-transferase, C-terminal

Iprscan IPR004045 [PS50404]

1

81

Glutathione S-transferase, N-terminal

Iprscan IPR017933 [PS50405]

87

210

Glutathione S-transferase/chloride channel, C-terminal

Iprscan [seg]

115

128

-

Iprscan [SignalP-NN(euk)]

1

28

-

PDA1R249

93

147

S=191 I=67 E=1.25119e-15

PDA1W7J2

1

30

S=133 I=87 E=1.14004e-08

PD966893

74

114

S=117 I=46 E=1.09913e-06

Iprscan IPR010987 [SSF47616]

80

208

Glutathione S-transferase, C-terminal-like

Iprscan IPR012336 [SSF52833]

1

85

Thioredoxin-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 3wHtkKm2)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

93 hits
swiss-prot

Swiss-Prot ncbi-blastp

33 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

7 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbE9Km4/XFF4834R_chr30370.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbE9Km4/XFF4834R_chr30370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbE9Km4/XFF4834R_chr30370.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbE9Km4/XFF4834R_chr30370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.