Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr30180XFF4834R_chr32760368_3468565_r3_acur-XFF4834R_chr30180XFF4834R_chr30180conserved hypothetical protein (partial)

XFF4834R_chr32760368_3468565_r3_acur-XFF4834R_chr30180 XFF4834R_chr30180
XFF4834R_chr30170
XFF4834R_chr30170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3187
XFF4834R_chr_3187
ID XFF4834R_chr32760368_3468565_r3_acur-XFF4834R_chr30180
AC XFF4834R_chr30180
LT XFF4834R_chr30180
OR XFF4834R_chr from 3468368 to 3468565 on strand -
DE conserved hypothetical protein (partial)
IP
CL 10.1 Partial similarity
EC
GO InterPro


Curated
PM
AN
CC COG: []
CC MODEL: acur
CC STATUS: curated by lgagnevin (20101026)
MW 7127.1 Da
SQ 65 aa
 
........10........20........30........40........50
| | | | |
MGAGEGNVRCDVTRRGQRAVHKQEPRLFCVTAPFSKRRLTFWCGVLADCG
TDCGMDAAIEPPWTG
Show or not Domain decomposition
 
X.species

YP_365264.1 lcl|XCV3533

37

64

S=110 I=79 E=2.73233e-07

hypothetical protein

PDA4L1A3

37

64

S=110 I=79 E=7.46389e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wEiWpwu0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoMiHvl/XFF4834R_chr30180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoMiHvl/XFF4834R_chr30180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoMiHvl/XFF4834R_chr30180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoMiHvl/XFF4834R_chr30180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.