Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr29990XFF4834R_chr32580197_3447592_f2_XFF4834R-XFF4834R_chr29990XFF4834R_chr29990outer membrane lipoprotein A - OmlA

XFF4834R_chr32580197_3447592_f2_XFF4834R-XFF4834R_chr29990 XFF4834R_chr29990
XFF4834R_chr29980
XFF4834R_chr29980
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30000
XFF4834R_chr30000
ID XFF4834R_chr32580197_3447592_f2_XFF4834R-XFF4834R_chr29990
AC XFF4834R_chr29990
LT XFF4834R_chr29990
OR XFF4834R_chr from 3447197 to 3447592 on strand +
DE outer membrane lipoprotein A - OmlA
IP SmpA/OmlA
CL 7.4 Outer membrane GO:0009279
EC
GO InterPro
Cellular Component: outer membrane (GO:0019867)

Curated
PM
AN PUBMED 10548726 + PMID 17957353: Arch Microbiol. 2008 Mar;189(3):211-8. Epub 2007 Oct 24. The omlA gene is involved in multidrug resistance and its expression is inhibited by coumarins in Xanthomonas campestris pv. phaseoli
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100823)
MW 14893.8 Da
SQ 131 aa
 
........10........20........30........40........50
| | | | |
MRNLLLVAAVALSTAGCGIIYKQPIYQGNLIKQNAVEQLQVGQSKQQVSA
LLGTPSIPDPFHAQRWDYTSTQRVDRLARTEIKNFTVFFENEQVARWEGD
YFPSQDEQLAKAAPKQFGRNLARDKKKQRGR
Show or not Domain decomposition
 
X.species

YP_363290.1 lcl|smpA-XCV1559

1

131

S=645 I=93 E=1.12198e-71

putative outer membrane protein

X.species

NP_641849.1 lcl|smpA-XAC1516

1

131

S=641 I=92 E=2.97901e-71

outer membrane protein

X.species

NP_636841.1 lcl|smpA-XCC1469

1

131

S=625 I=89 E=2.87211e-69

outer membrane protein

X.species

lcl|smpA-XALc_1682

1

129

S=545 I=77 E=1.28826e-59

probable small membrane lipoprotein a (smpa)

pubmed

1

131

S=601 I=89 E=7.10245e-65

Outer membrane lipoprotein A

Pubmed 10548726

 

prodomImg

pubmed

21

110

S=175 I=38 E=3.24113e-13

Outer membrane lipoprotein

Pubmed 11320133

 

prodomImg

pubmed

21

105

S=171 I=40 E=9.06784e-13

Outer membrane lipoprotein

Pubmed 11320133

 

prodomImg

pubmed

13

109

S=162 I=35 E=1.11691e-11

Outer membrane lipoprotein omlA ; Cell Palmitate Signal

Pubmed 9973334

 

prodomImg

pubmed

20

109

S=155 I=37 E=9.79168e-11

Outer membrane lipoprotein omlA ; Cell Palmitate Signal

Pubmed 9973334

 

prodomImg

sp

13

109

S=162 I=35 E=7.81767e-12

Outer membrane lipoprotein omlA ; Cell Palmitate Signal

 

prodomImg

sp

20

109

S=155 I=37 E=6.85357e-11

Outer membrane lipoprotein omlA ; Cell Palmitate Signal

 

prodomImg

sp

14

68

S=127 I=42 E=1.31467e-07

Small protein A ; Cell membrane outer Lipoprotein Palmitate Signal

 

prodomImg

sp

14

68

S=127 I=42 E=1.31467e-07

Small protein A ; Cell membrane outer Lipoprotein Palmitate Signal

 

prodomImg

sp

14

68

S=127 I=42 E=1.31467e-07

Small protein A ; Cell membrane outer Lipoprotein Palmitate Signal

 

prodomImg

Iprscan IPR007450 [PF04355]

28

99

SmpA/OmlA

Iprscan [PS51257]

1

17

-

Iprscan [seg]

4

12

-

Iprscan [SignalP-NN(euk)]

1

18

-

Iprscan [tmhmm]

4

21

-

PDA4O454

13

103

S=105 I=28 E=2.99235e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one qdnCSiWi)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

6 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9gvewG/XFF4834R_chr29990.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9gvewG/XFF4834R_chr29990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9gvewG/XFF4834R_chr29990.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9gvewG/XFF4834R_chr29990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.