Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr29980furXFF4834R_chr29980ferric uptake regulator

fur XFF4834R_chr29980
XFF4834R_chr_3164
XFF4834R_chr_3164
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr29990
XFF4834R_chr29990
ID fur
AC XFF4834R_chr29980
LT XFF4834R_chr29980
OR XFF4834R_chr from 3446682 to 3447092 on strand -
DE ferric uptake regulator
IP Ferric-uptake regulator
CL 3.1.2 Transcriptional level GO:0006355
EC
GO InterPro
DNA-dependent (GO:0006355)
Molecular Function: transcription factor activity (GO:0003700)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100729)
MW 15765.7 Da
SQ 136 aa
 
........10........20........30........40........50
| | | | |
METHDLRKVGLKVTHPRMRILELLEQKSNQHHLSAEDIYRQLLDHGDEIG
LATVYRVLTQFEAAGLVLKHNFEGGQAVYELDRGGHHDHMVDVDTGHVIE
FESEEIEALQRQIAAKHGYELEEHSLVLYVRKKRPR
Show or not Domain decomposition
 
X.species

YP_363291.1 lcl|fur-XCV1560

1

136

S=698 I=100 E=4.28542e-78

ferric uptake regulator

X.species

NP_636842.1 lcl|fur-XCC1470

1

136

S=698 I=100 E=4.92694e-78

ferric uptake regulator Fur

X.species

NP_641850.1 lcl|fur-XAC1517

1

136

S=690 I=99 E=3.95869e-77

ferric uptake regulator

X.species

lcl|fur-XALc_1681

1

134

S=617 I=90 E=2.63093e-68

probable ferric-uptake regulator protein

pubmed

1

136

S=691 I=99 E=1.11487e-75

Ferric uptake regulator Fur

Pubmed 10548726

 

prodomImg

pubmed

1

136

S=688 I=99 E=2.42228e-75

Ferric uptake regulator protein

Pubmed 16042010

 

prodomImg

pubmed

1

134

S=452 I=63 E=9.14067e-47

Ferric uptake regulator

Pubmed 19501788

 

prodomImg

pubmed

1

134

S=432 I=61 E=2.83464e-44

Ferric uptake regulation protein ; Cytoplasm DNA-binding Iron Metal-binding Repressor Transcription Zinc

Pubmed 8478325,9852033

 

prodomImg

pubmed

1

134

S=431 I=61 E=3.11997e-44

Ferric uptake regulation protein ; Cytoplasm DNA-binding Iron Metal-binding Repressor Transcription Zinc

Pubmed 7623664

 

prodomImg

sp

1

134

S=432 I=61 E=1.97846e-44

Ferric uptake regulation protein ; Cytoplasm DNA-binding Iron Metal-binding Repressor Transcription Zinc

 

prodomImg

sp

1

134

S=431 I=61 E=2.17761e-44

Ferric uptake regulation protein ; Cytoplasm DNA-binding Iron Metal-binding Repressor Transcription Zinc

 

prodomImg

sp

1

121

S=407 I=63 E=2.17216e-41

Ferric uptake regulation protein ; Cytoplasm DNA-binding Iron Metal-binding Repressor Transcription Zinc

 

prodomImg

sp

6

129

S=399 I=61 E=1.70022e-40

Ferric uptake regulation protein ; Cytoplasm DNA-binding Iron Metal-binding Repressor Transcription Zinc

 

prodomImg

sp

6

129

S=399 I=61 E=1.70022e-40

Ferric uptake regulation protein ; Cytoplasm DNA-binding Iron Metal-binding Repressor Transcription Zinc

 

prodomImg

Iprscan IPR002481 [PF01475]

9

129

Ferric-uptake regulator

PDA7C4D5

6

73

S=132 I=46 E=1.56712e-08

PDA133P9

6

69

S=115 I=41 E=1.86254e-06

PDA1F8P4

50

75

S=114 I=81 E=2.23678e-06

PDA094A0

6

42

S=108 I=57 E=1.17235e-05

Iprscan [SSF46785]

6

134

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one a9FKH1l7)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

102 hits
swiss-prot

Swiss-Prot ncbi-blastp

54 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZusfCA/XFF4834R_chr29980.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZusfCA/XFF4834R_chr29980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZusfCA/XFF4834R_chr29980.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZusfCA/XFF4834R_chr29980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.