Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr29960hrcAXFF4834R_chr29960heat-inducible transcription repressor

hrcA XFF4834R_chr29960
XFF4834R_chr29950
XFF4834R_chr29950
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr29970
XFF4834R_chr29970
ID hrcA
AC XFF4834R_chr29960
LT XFF4834R_chr29960
OR XFF4834R_chr from 3443469 to 3444521 on strand -
DE heat-inducible transcription repressor
IP Winged helix-turn-helix transcription repressor, HrcA
CL 3.1.2.3 Repressor GO:0016564
EC
GO InterPro
DNA-dependent (GO:0006355)
Molecular Function: DNA binding (GO:0003677)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120315)
MW 38215.5 Da
SQ 350 aa
 
........10........20........30........40........50
| | | | |
MRASQSPMLDPRARQLLRTLIARYIRDGEPVGSKTLAQHAGLDVSPATIR
NILADLEDVGLLSSPHTSAGRVPTAHGYRVFVDSLVQMQPPGEEEVRRLR
AELASGNGTQSLLGSASQMLSAMSHFVGVVSAPRREQFAFRHIDFVALDA
RRVLAILVFADNEVQNRVIEPRRAYEPAELERVANYLNAQFAGRALADIR
ACLLRELRMAKSEMEQLLAHSVDLASEALVPADADDMVMAGQTRLMGVQD
LSDLDRLRELFEAFASKREILQLLERTIQAPGVRIFIGEETGMVSLEDVS
LVTAPYAANGQVLGVLGVIGPKRMAYDRLIPLVQTAADVLGAAMESPGTR
Show or not Domain decomposition
 
Hamap HRCA_MF_00081 raw_score=4448 norm_score=28.056

Heat-inducible transcription repressor hrcA [hrcA].

X.species

YP_363293.1 lcl|hrcA-XCV1562

1

350

S=1724 I=96 E=0

heat-inducible transcription repressor

X.species

NP_641853.1 lcl|hrcA-XAC1520

8

350

S=1680 I=96 E=0

heat-inducible transcription repressor

X.species

NP_636844.1 lcl|hrcA-XCC1472

1

350

S=1636 I=92 E=0

heat-inducible transcription repressor

X.species

lcl|hrcA-XALc_1679

9

345

S=1412 I=82 E=5.15667e-164

probable heat-inducible transcriptional repressor protein

pubmed

1

350

S=1639 I=92 E=0

Heat-inducible transcription repressor hrcA ; Stress response regulation

Pubmed 11479711

 

prodomImg

pubmed

9

346

S=571 I=38 E=1.54845e-60

Heat-inducible transcription repressor hrcA ; Stress response regulation

Pubmed 8606155

 

prodomImg

pubmed

9

337

S=531 I=38 E=1.28401e-55

Heat-inducible transcription repressor hrcA ; Stress response regulation

Pubmed 17965706

 

prodomImg

pubmed

9

340

S=521 I=36 E=1.80251e-54

Heat-inducible transcription repressor hrcA ; Stress response regulation

Pubmed 10613857

 

prodomImg

pubmed

5

340

S=521 I=34 E=1.94965e-54

Heat-inducible transcription repressor hrcA ; Stress response regulation

Pubmed 10601208

 

prodomImg

pubmed

9

340

S=517 I=34 E=6.27117e-54

HrcA ; Repressor Stress response Transcription regulation

Pubmed 16944097

 

prodomImg

pubmed

9

341

S=513 I=35 E=2.07062e-53

Transcriptional regulator of heat shock protein ; Repressor Stress response regulation

Pubmed 18028413

 

prodomImg

pubmed

9

346

S=474 I=29 E=8.62255e-49

Heat-inducible transcription repressor hrcA ; Stress response regulation

Pubmed 18441057

 

prodomImg

pubmed

8

344

S=453 I=31 E=3.59664e-46

Heat-inducible transcription repressor hrcA ; Stress response regulation

Pubmed 19014707

 

prodomImg

pubmed

8

344

S=427 I=29 E=5.04061e-43

Heat-inducible transcription repressor hrcA ; Stress response regulation

Pubmed 11114912

 

prodomImg

sp

1

350

S=1724 I=96 E=0

Heat-inducible transcription repressor hrcA ; Stress response regulation

 

prodomImg

sp

1

350

S=1714 I=96 E=0

Heat-inducible transcription repressor hrcA ; Stress response regulation

 

prodomImg

sp

1

350

S=1705 I=95 E=0

Heat-inducible transcription repressor hrcA ; Stress response regulation

 

prodomImg

sp

1

350

S=1639 I=92 E=0

Heat-inducible transcription repressor hrcA ; Stress response regulation

 

prodomImg

sp

1

347

S=1415 I=78 E=6.9396e-163

Heat-inducible transcription repressor hrcA ; Stress response regulation

 

prodomImg

Iprscan [coil]

200

221

-

Iprscan IPR011991 [G3DSA:1.10.10.10]

9

92

Winged helix repressor DNA-binding

Iprscan IPR002571 [MF_00081]

8

337

Negative regulator of class I heat shock protein

Iprscan IPR002571 [PIRSF005485]

6

348

Negative regulator of class I heat shock protein

Iprscan IPR002571 [PF01628]

109

330

Negative regulator of class I heat shock protein

Iprscan IPR002571 [TIGR00331]

10

344

Negative regulator of class I heat shock protein

Iprscan [seg]

93

104

-

PD011240

110

341

S=350 I=40 E=6.25016e-35

PD003513

12

90

S=278 I=62 E=2.85514e-26

PDA1G831

107

204

S=219 I=40 E=4.70659e-19

PDA076H9

8

81

S=150 I=34 E=1.09871e-10

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Q4tMbmbr)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

42 hits
swiss-prot

Swiss-Prot ncbi-blastp

317 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeYkJ6J/XFF4834R_chr29960.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeYkJ6J/XFF4834R_chr29960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeYkJ6J/XFF4834R_chr29960.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBeYkJ6J/XFF4834R_chr29960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.