Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr29950grpEXFF4834R_chr29950probable heat shock protein GrpE

grpE XFF4834R_chr29950
XFF4834R_chr29940
XFF4834R_chr29940
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr29960
XFF4834R_chr29960
ID grpE
AC XFF4834R_chr29950
LT XFF4834R_chr29950
OR XFF4834R_chr from 3442850 to 3443368 on strand -
DE probable heat shock protein GrpE
IP GrpE nucleotide exchange factor
CL 2.3.4 Chaperoning, folding GO:0006457
EC
GO InterPro
Biological Process: protein folding (GO:0006457)
Biological Process: protein import into mitochondrial matrix (GO:0030150)
Cellular Component: mitochondrion (GO:0005739)
Molecular Function: protein binding (GO:0005515)
Molecular Function: adenyl-nucleotide exchange factor activity (GO:0000774)
Molecular Function: protein homodimerization activity (GO:0042803)
Molecular Function: chaperone binding (GO:0051087)

Curated
PM
AN xyllela and Xcc prot 25 aa longer. not the general case and corresponds to region with low coding probability in phaseoli.
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100802)
MW 18938.1 Da
SQ 172 aa
 
........10........20........30........40........50
| | | | |
MNQDHPEFDSEDLSQNPPETDPLKAEIESLRSEIALVKADALRERADLEN
QRKRIARDVENARKFANEKLLGELLPVFDSLDAGLTAAGTEPSPLRDGLD
MTYKQLLKVAADNGLTLLDPVGQPFNPDQHQAISQGEAEGVAPGHVVQVF
QKGYLLNDRLLRPALVVVAKHD
X.species

YP_363294.1 lcl|grpE-XCV1563

1

172

S=885 I=100 E=1.46532e-100

heat shock protein GrpE

X.species

NP_641854.1 lcl|grpE-XAC1521

1

172

S=885 I=100 E=1.46532e-100

heat shock protein GrpE

X.species

NP_636845.1 lcl|grpE-XCC1473

1

172

S=875 I=98 E=2.1865e-99

GrpE protein

X.species

lcl|grpE-XALc_1678

1

172

S=756 I=84 E=6.09911e-85

probable protein grpe (hsp-70 cofactor).

pubmed

1

172

S=875 I=98 E=7.83016e-98

Protein grpE ; Chaperone Cytoplasm Stress response

Pubmed 11479711

 

prodomImg

pubmed

7

170

S=322 I=43 E=9.87247e-31

Protein grpE ; Chaperone Cytoplasm Stress response

Pubmed 16109938

 

prodomImg

pubmed

12

170

S=288 I=36 E=1.05504e-26

Protein grpE ; Chaperone Cytoplasm Stress response

Pubmed 18281406

 

prodomImg

pubmed

41

169

S=285 I=45 E=2.97757e-26

Protein grpE ; Chaperone Cytoplasm Stress response

Pubmed 9332363

 

prodomImg

pubmed

1

170

S=284 I=38 E=3.48352e-26

Protein grpE ; Chaperone Cytoplasm Stress response

Pubmed 3045760

 

prodomImg

sp

1

172

S=885 I=100 E=3.67492e-99

Protein grpE ; Chaperone Cytoplasm Stress response

 

prodomImg

sp

1

172

S=885 I=100 E=3.67492e-99

Protein grpE ; Chaperone Cytoplasm Stress response

 

prodomImg

sp

1

172

S=875 I=98 E=5.3888e-98

Protein grpE ; Chaperone Cytoplasm Stress response

 

prodomImg

sp

1

172

S=870 I=98 E=2.56611e-97

Protein grpE ; Chaperone Cytoplasm Stress response

 

prodomImg

sp

1

172

S=870 I=98 E=2.56611e-97

Protein grpE ; Chaperone Cytoplasm Stress response

 

prodomImg

Iprscan [coil]

38

66

-

Iprscan IPR000740 [PR00773]

42

58

GrpE nucleotide exchange factor

Iprscan IPR000740 [PR00773]

70

85

GrpE nucleotide exchange factor

Iprscan IPR000740 [PR00773]

122

137

GrpE nucleotide exchange factor

Iprscan IPR000740 [PR00773]

149

168

GrpE nucleotide exchange factor

Iprscan IPR013805 [G3DSA:3.90.20.20]

13

112

GrpE nucleotide exchange factor, coiled-coil

Iprscan IPR009012 [G3DSA:2.30.22.10]

114

170

GrpE nucleotide exchange factor, head

Iprscan IPR000740 [MF_01151]

3

170

GrpE nucleotide exchange factor

Iprscan IPR000740 [PTHR21237]

9

171

GrpE nucleotide exchange factor

Iprscan IPR000740 [PF01025]

12

170

GrpE nucleotide exchange factor

Iprscan IPR000740 [PS01071]

125

168

GrpE nucleotide exchange factor

PD707371

1

41

S=177 I=80 E=5.14008e-14

PD002432

120

171

S=146 I=58 E=3.22726e-10

PD799410

124

164

S=122 I=54 E=2.77572e-07

PDA1A4J9

46

114

S=101 I=32 E=9.07016e-05

Iprscan IPR009012 [SSF51064]

115

172

GrpE nucleotide exchange factor, head

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one BnyicVEg)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

76 hits
swiss-prot

Swiss-Prot ncbi-blastp

580 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuakwkh/XFF4834R_chr29950.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuakwkh/XFF4834R_chr29950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuakwkh/XFF4834R_chr29950.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuakwkh/XFF4834R_chr29950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.