Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr29930dnaJXFF4834R_chr29930probable chaperone Hsp40, co-chaperone with DnaK

dnaJ XFF4834R_chr29930
XFF4834R_chr29920
XFF4834R_chr29920
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr29940
XFF4834R_chr29940
ID dnaJ
AC XFF4834R_chr29930
LT XFF4834R_chr29930
OR XFF4834R_chr from 3439495 to 3440622 on strand -
DE probable chaperone Hsp40, co-chaperone with DnaK
IP Chaperone DnaJ; Molecular chaperone, heat shock protein, Hsp40, DnaJ
CL 2.3.4 Chaperoning, folding GO:0006457
EC
GO InterPro
Biological Process: protein folding (GO:0006457)
Biological Process: response to heat (GO:0009408)
Molecular Function: unfolded protein binding (GO:0051082)
Molecular Function: heat shock protein binding (GO:0031072)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by lnoel (20100802)
MW 40316.9 Da
SQ 375 aa
 
........10........20........30........40........50
| | | | |
MSKRDYYEVLGVARGASDEELKKAYRRCAMKHHPDRNPGDAAAEAAFKEC
KEAYEVLSDGNKRRAYDAHGHAAFEHGMGGGGGPGGPDMGDIFGDIFGNI
FGGGAAGPRAARRGADVGYVLELDLEEAVAGIERRIEIPTLIECAPCHGS
GSEDGKVETCGTCHGRGQVRIQRGIFAMQQSCPHCDGRGTLIQNPCKTCH
GAGRVEEDKVLSIKVPAGVDTGDRIRLAGEGEAGPAGTPPGDLYVEVRVR
EHAIFQRDGDDLHCEVPIRISQAALGDTVRVATLGGEAEIRIPAETQTGK
LFRLRGKGVRSVRSRSEGDLYCRVVVETPVNLTADQRELLQQFEATFTGE
DARKHSPKSATFIDGVKGFWDRMTS
XFF4834R

XFF4834R_chr33930 lcl|cbpA-XFF4834R_chr33930

209

308

S=138 I=35 E=4.28764e-10

curved DNA-binding protein, DnaJ homologue that functions as a co-chaperone of DnaK

XFF4834R

XFF4834R_chr33930 lcl|cbpA-XFF4834R_chr33930

1

67

S=114 I=40 E=3.29257e-07

curved DNA-binding protein, DnaJ homologue that functions as a co-chaperone of DnaK

X.species

NP_641856.1 lcl|dnaJ-XAC1523

1

375

S=1506 I=80 E=2.50389e-175

DnaJ protein

X.species

YP_363296.1 lcl|dnaJ-XCV1565

1

375

S=1504 I=79 E=4.04457e-175

DnaJ protein

X.species

NP_636847.1 lcl|dnaJ-XCC1475

1

375

S=1467 I=78 E=1.39029e-170

DnaJ protein

X.species

lcl|dnaJ-XALc_1676

1

375

S=1349 I=71 E=2.73629e-156

probable chaperone protein dnaj

X.species

lcl|cbpA-XALc_0652

182

352

S=163 I=30 E=1.27273e-12

probable curved dna binding protein

X.species

lcl|cbpA-XALc_0652

1

67

S=113 I=42 E=1.61652e-06

probable curved dna binding protein

X.species

YP_362904.1 lcl|cbpA-XCV1173

195

308

S=138 I=32 E=1.56503e-09

curved DNA binding protein

X.species

YP_362904.1 lcl|cbpA-XCV1173

1

67

S=114 I=40 E=1.17079e-06

curved DNA binding protein

X.species

NP_641488.1 lcl|cbpA-XAC1152

209

308

S=138 I=35 E=1.62057e-09

curved DNA binding protein

X.species

NP_641488.1 lcl|cbpA-XAC1152

1

67

S=114 I=40 E=1.24447e-06

curved DNA binding protein

X.species

NP_636423.1 lcl|cbpA-XCC1048

209

308

S=136 I=34 E=2.48432e-09

curved DNA binding protein

X.species

NP_636423.1 lcl|cbpA-XCC1048

1

67

S=108 I=39 E=5.47888e-06

curved DNA binding protein

pubmed

1

375

S=1467 I=78 E=5.86743e-169

Chaperone protein dnaJ ; Cytoplasm replication Metal-binding Repeat Stress response Zinc Zinc-finger

Pubmed 11479711

 

prodomImg

pubmed

1

374

S=938 I=48 E=8.02177e-105

Chaperone protein dnaJ ; Cytoplasm replication Metal-binding Repeat Stress response Zinc Zinc-finger

Pubmed 3003084,3003085

 

prodomImg

pubmed

1

374

S=929 I=48 E=9.21492e-104

Chaperone protein dnaJ ; Cytoplasm replication Metal-binding Repeat Stress response Zinc Zinc-finger

Pubmed 14977940

 

prodomImg

pubmed

1

375

S=911 I=47 E=1.29253e-101

Chaperone protein dnaJ ; Cytoplasm replication Metal-binding Repeat Stress response Zinc Zinc-finger

Pubmed 10024539

 

prodomImg

pubmed

1

370

S=896 I=50 E=8.05829e-100

Chaperone protein dnaJ ; Cytoplasm replication Metal-binding Repeat Stress response Zinc Zinc-finger

Pubmed 14602651

 

prodomImg

sp

1

375

S=1506 I=80 E=7.18973e-174

Chaperone protein dnaJ ; Cytoplasm replication Metal-binding Repeat Stress response Zinc Zinc-finger

 

prodomImg

sp

1

375

S=1504 I=79 E=1.16137e-173

Chaperone protein dnaJ ; Cytoplasm replication Metal-binding Repeat Stress response Zinc Zinc-finger

 

prodomImg

sp

1

375

S=1478 I=78 E=1.9042e-170

Chaperone protein dnaJ ; Cytoplasm replication Metal-binding Repeat Stress response Zinc Zinc-finger

 

prodomImg

sp

1

375

S=1478 I=78 E=1.9042e-170

Chaperone protein dnaJ ; Cytoplasm replication Metal-binding Repeat Stress response Zinc Zinc-finger

 

prodomImg

sp

1

375

S=1478 I=78 E=1.9042e-170

Chaperone protein dnaJ ; Cytoplasm replication Metal-binding Repeat Stress response Zinc Zinc-finger

 

prodomImg

Iprscan IPR003095 [PR00625]

16

35

Heat shock protein DnaJ

Iprscan IPR003095 [PR00625]

47

67

Heat shock protein DnaJ

Iprscan IPR003095 [PR00625]

136

155

Heat shock protein DnaJ

Iprscan IPR003095 [PR00625]

160

170

Heat shock protein DnaJ

Iprscan IPR003095 [PR00625]

174

192

Heat shock protein DnaJ

Iprscan IPR003095 [PR00625]

194

209

Heat shock protein DnaJ

Iprscan IPR003095 [PR00625]

213

229

Heat shock protein DnaJ

Iprscan IPR003095 [PR00625]

259

276

Heat shock protein DnaJ

Iprscan IPR001623 [G3DSA:1.10.287.110]

2

78

Heat shock protein DnaJ, N-terminal

Iprscan IPR001305 [G3DSA:2.10.230.10]

131

208

Heat shock protein DnaJ, cysteine-rich domain

Iprscan [G3DSA:2.60.260.20]

252

341

-

Iprscan [PTHR11821:SF79]

1

331

-

Iprscan IPR015609 [PTHR11821]

1

331

Molecular chaperone, heat shock protein, Hsp40, DnaJ

Iprscan IPR001623 [PF00226]

5

67

Heat shock protein DnaJ, N-terminal

Iprscan IPR002939 [PF01556]

241

339

Chaperone DnaJ, C-terminal

Iprscan IPR001305 [PF00684]

131

203

Heat shock protein DnaJ, cysteine-rich domain

Iprscan IPR001623 [SM00271]

4

62

Heat shock protein DnaJ, N-terminal

Iprscan IPR012724 [TIGR02349]

5

347

Chaperone DnaJ

Iprscan IPR001305 [PS51188]

131

208

Heat shock protein DnaJ, cysteine-rich domain

Iprscan IPR001623 [PS50076]

5

70

Heat shock protein DnaJ, N-terminal

PD000802

139

209

S=179 I=49 E=3.2838e-14

PD788343

117

257

S=157 I=29 E=1.77923e-11

PD000231

1

38

S=151 I=64 E=8.32615e-11

PD693097

119

227

S=150 I=31 E=1.13962e-10

PD531284

259

304

S=138 I=59 E=3.35678e-09

PD893636

324

367

S=125 I=59 E=1.32993e-07

PDA2F2D8

119

251

S=121 I=25 E=3.65647e-07

PDA1U154

207

258

S=112 I=40 E=5.17797e-06

PDA569G7

208

286

S=109 I=31 E=1.12502e-05

PD930339

290

346

S=108 I=35 E=1.23826e-05

Iprscan IPR001305 [SSF57938]

131

208

Heat shock protein DnaJ, cysteine-rich domain

Iprscan IPR001623 [SSF46565]

1

115

Heat shock protein DnaJ, N-terminal

Iprscan IPR008971 [SSF49493]

109

253

HSP40/DnaJ peptide-binding

Iprscan IPR008971 [SSF49493]

254

341

HSP40/DnaJ peptide-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one quehR2em)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

24 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJZD1S5/XFF4834R_chr29930.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJZD1S5/XFF4834R_chr29930.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJZD1S5/XFF4834R_chr29930.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJZD1S5/XFF4834R_chr29930.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.