Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr29860XFF4834R_chr32430654_3431766_f1_XFF4834R-XFF4834R_chr29860XFF4834R_chr29860putative LysR family transcriptional regulator

XFF4834R_chr32430654_3431766_f1_XFF4834R-XFF4834R_chr29860 XFF4834R_chr29860
XFF4834R_chr29850
XFF4834R_chr29850
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr29870
XFF4834R_chr29870
ID XFF4834R_chr32430654_3431766_f1_XFF4834R-XFF4834R_chr29860
AC XFF4834R_chr29860
LT XFF4834R_chr29860
OR XFF4834R_chr from 3430654 to 3431766 on strand +
DE putative LysR family transcriptional regulator
IP HTH-type transcriptional regulator HdfR
CL 3.1.2 Transcriptional level GO:0006355
EC
GO InterPro
DNA-dependent (GO:0006355)
Molecular Function: transcription factor activity (GO:0003700)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120315)
MW 39660.4 Da
SQ 370 aa
 
........10........20........30........40........50
| | | | |
MASGAPSETTALTALRARPVLGIGMHRSYTAVTARCPSSPDELPLQSLAA
LRLSGLTGHAGVCSHAIRCDPMPRPRTTLRQLSYFVALADTGSFTRAAEQ
MGVSQPSLSQQIRALEAIIGAPLLERGTQAILTPLGRDLLDRARSILLDV
TDLEEVRATAADTLIGTIRLGVSPTLGAYLMPSLVARLHREHPALRVHVR
EGLPTALAADLSNGTHDLVLAQLPVAGRGLHSERLFRELLHVTMAADHPL
RTKACITPADLRGANLLTLMPEYRLAEQVAAIAMDVGANVLRDYEGTSLD
AIRQMAGMGMGLALLPDLYVRQEIREGDDVVVRPVEGGRYYREIGLLWRQ
GAGRAPAFGLIANLLRAVAA
XFF4834R

XFF4834R_chr09110 lcl|oxyR-XFF4834R_chr09110

78

368

S=367 I=34 E=6.06519e-38

DNA-binding transcriptional dual regulator

XFF4834R

XFF4834R_chr12520 lcl|XFF4834R_chr13170407_1418276_r2_XFF4834R-XFF4834R_chr12520

79

317

S=235 I=32 E=7.12478e-22

XFF4834R

XFF4834R_chr02900 lcl|XFF4834R_chr03040090_0338977_r3_XFF4834R-XFF4834R_chr02900

79

316

S=220 I=29 E=4.03574e-20

predicted DNA-binding transcriptional regulator

XFF4834R

XFF4834R_chr11710 lcl|XFF4834R_chr12200819_1307721_f1_XFF4834R-XFF4834R_chr11710

76

269

S=211 I=28 E=4.84259e-19

predicted DNA-binding transcriptional regulator

XFF4834R

XFF4834R_chr05050 lcl|XFF4834R_chr05180587_0570588_r1_XFF4834R-XFF4834R_chr05050

78

317

S=211 I=30 E=5.33002e-19

XFF4834R

XFF4834R_chr11880 lcl|XFF4834R_chr12460277_1335161_r2_XFF4834R-XFF4834R_chr11880

79

324

S=184 I=27 E=8.9708e-16

XFF4834R

XFF4834R_chr06800 lcl|XFF4834R_chr07150040_0780948_f1_XFF4834R-XFF4834R_chr06800

76

349

S=176 I=28 E=9.69499e-15

predicted DNA-binding transcriptional regulator

XFF4834R

XFF4834R_chr40240 lcl|XFF4834R_chr_4650443_4651750_r3_XFF4834R-XFF4834R_chr40240

61

250

S=172 I=34 E=2.48593e-14

XFF4834R

XFF4834R_chr08830 lcl|XFF4834R_chr_1023585_1024586_f3_XFF4834R-XFF4834R_chr08830

76

250

S=159 I=29 E=9.5115e-13

predicted DNA-binding transcriptional regulator

XFF4834R

XFF4834R_chr13100 lcl|cysB-XFF4834R_chr13100

78

220

S=152 I=30 E=8.48519e-12

DNA-binding transcriptional dual regulator, O-acetyl-L-serine-binding

X.species

NP_641862.1 lcl|oxyR-XAC1529

72

370

S=1495 I=98 E=4.98408e-174

hydrogen peroxide-inducible genes activator

X.species

YP_363303.1 lcl|XCV1572

72

370

S=1492 I=98 E=1.32335e-173

LysR family transcriptional regulator

X.species

NP_636853.1 lcl|oxyR-XCC1481

72

370

S=1381 I=90 E=3.53688e-160

hydrogen peroxide-inducible genes activator protein

X.species

NP_636223.1 lcl|oxyR-XCC0832

78

353

S=404 I=37 E=9.12442e-42

oxidative stress transcriptional regulator

X.species

YP_362672.1 lcl|oxyR-XCV0941

78

368

S=369 I=34 E=1.63099e-37

LysR family transcriptional regulator

X.species

NP_641257.1 lcl|oxyR-XAC0905

78

368

S=368 I=34 E=1.68887e-37

oxidative stress transcriptional regulator

X.species

lcl|oxyR-XALc_0458

78

368

S=361 I=34 E=1.48059e-36

probable oxydative stress transcriptional regulator, lysr family transcription regulator protein

X.species

NP_638737.1 lcl|ybhD-XCC3391

76

327

S=254 I=30 E=1.14736e-23

transcriptional regulator

X.species

NP_638592.1 lcl|XCC3246

79

317

S=229 I=32 E=1.31582e-20

transcriptional regulator

X.species

NP_635886.1 lcl|XCC0494

78

317

S=223 I=31 E=6.15753e-20

LysR family transcriptional regulator

pubmed

78

365

S=415 I=37 E=1.48119e-41

Transcription factor OxyR Transcriptional regulator OxyR ; DNA-binding regulation

Pubmed 10986275

 

prodomImg

pubmed

74

366

S=412 I=37 E=3.33239e-41

OxyR ; DNA-binding Transcription regulation

Pubmed 19332821

 

prodomImg

pubmed

78

367

S=408 I=36 E=9.90988e-41

Hydrogen peroxide-inducible genes activator ; Disulfide bond DNA-binding Glutathionylation Oxidation S-nitrosylation Transcription regulation

Pubmed 2471187,2551682

 

prodomImg

pubmed

78

366

S=382 I=34 E=1.40101e-37

Hydrogen peroxide-inducible genes activator ; DNA-binding Transcription regulation

Pubmed 9809430

 

prodomImg

pubmed

78

368

S=367 I=34 E=8.73462e-36

Oxidative stress transcriptional regulator ; DNA-binding regulation

Pubmed 9190810

 

prodomImg

pubmed

78

367

S=334 I=31 E=1.01848e-31

Oxidative stress regulatory protein Oxidative stress regulatory protein OxyR ; DNA-binding Transcription regulation

Pubmed 12383513

 

prodomImg

pubmed

78

348

S=321 I=36 E=4.14205e-30

KatG regulator ; DNA-binding Plasmid Transcription regulation

Pubmed 12724378

 

prodomImg

pubmed

75

369

S=313 I=30 E=3.66304e-29

OxyR-like factor ; DNA-binding Transcription regulation

Pubmed 18838821

 

prodomImg

pubmed

78

352

S=311 I=31 E=6.56957e-29

Hydrogen peroxide-inducible genes activator ; DNA-binding Transcription regulation

Pubmed 8890216

 

prodomImg

pubmed

78

367

S=270 I=28 E=5.64096e-24

Redox-sensitive transcriptional activator OxyR ; DNA-binding regulation

Pubmed 10960088

 

prodomImg

Iprscan IPR011991 [G3DSA:1.10.10.10]

77

162

Winged helix repressor DNA-binding

Iprscan [G3DSA:3.40.190.10]

162

276

-

Iprscan IPR000847 [PF00126]

79

137

HTH transcriptional regulator, LysR

Iprscan IPR005119 [PF03466]

161

370

LysR, substrate-binding

Iprscan IPR000847 [PS50931]

77

133

HTH transcriptional regulator, LysR

PDA21102

204

292

S=371 I=81 E=2.12786e-37

PDA8N4B2

207

366

S=214 I=39 E=1.74396e-18

PD000161

84

147

S=166 I=52 E=1.32427e-12

PDA02930

123

327

S=135 I=23 E=7.95994e-09

PD764164

292

365

S=127 I=33 E=6.50815e-08

PD862041

79

125

S=113 I=47 E=3.71874e-06

PDA884T1

76

159

S=110 I=41 E=7.94003e-06

PDA33270

202

228

S=106 I=74 E=2.42379e-05

PDA1F7U3

164

201

S=106 I=47 E=2.62164e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one PJbNtcAE)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

297 hits
swiss-prot

Swiss-Prot ncbi-blastp

181 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

26 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMDrS7y/XFF4834R_chr29860.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMDrS7y/XFF4834R_chr29860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMDrS7y/XFF4834R_chr29860.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMDrS7y/XFF4834R_chr29860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.