Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr29620ugdXFF4834R_chr29620UDP-glucose dehydrogenase

ugd XFF4834R_chr29620
XFF4834R_chr29610
XFF4834R_chr29610
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr29630
XFF4834R_chr29630
ID ugd
AC XFF4834R_chr29620
LT XFF4834R_chr29620
OR XFF4834R_chr from 3404556 to 3405905 on strand -
DE UDP-glucose dehydrogenase
IP Fatty oxidation complex, alpha subunit FadB; Nucleotide sugar dehydrogenase
CL 1.6 Macromolecules (cellular constituent) biosynthesis GO:0009059
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: metabolic process (GO:0008152)
Molecular Function: binding (GO:0005488)
Molecular Function: coenzyme binding (GO:0050662)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: NAD or NADH binding (GO:0051287)
NAD or NADP as acceptor (GO:0016616)

Curated
PM
AN also 5.13 Virulence associated
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100827)
MW 48622.7 Da
SQ 449 aa
 
........10........20........30........40........50
| | | | |
MRVAIFGTGYVGLVTGACLAEVGHQVVCVDIDQAKLDALNRGLIPIYEPG
LEPMVKANHAAGRLRFTSDAAAAIAHGEITFIAVGTPADQDGSADLQYVL
AVARTVGRHIDGPAIVVNKSTVPVGTADRVRAAIQEELAARGVAHDVDVV
SNPEFLKEGGAVADCMRPDRIVIGAKKPAAIARMRRLYAPFNRNRDRIVE
MDVRSAELTKYAANAMLATKISFMNEIANIAERVGADVEHVRNGIGSDPR
IGWHFIYPGAGYGGSCFPKDVQALAKTAEQYGMQPTLLNAVESVNHAQKG
HLFELVQRHYGTEGTGSVAGKTFAVWGLAFKPNTDDMRAASSRRLMEQLW
EAGATVRAYDPEATREARRIFGERDDLTFCDDAFSALEGADALVVVTEWK
QFRSPDFGKIKQALKDDVVFDGRNLYDPQEIEAAGLAYYAIGRGRSLYA
XFF4834R

XFF4834R_chr34750 ugd-XFF4834R_chr34750

1

361

S=394 I=33 E=4.2568e-41

UDP-glucose 6-dehydrogenase

XFF4834R

XFF4834R_chr22040 rffD-XFF4834R_chr22040

2

426

S=225 I=27 E=1.46922e-20

UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase

X.species

NP_641884.1 ugd-XAC1551

1

449

S=2315 I=98 E=0

UDP-glucose dehydrogenase

X.species

YP_363325.1 ugd1-XCV1594

1

449

S=2311 I=98 E=0

UDP-glucose dehydrogenase

X.species

NP_636875.1 ugd-XCC1503

1

449

S=2220 I=92 E=0

UDP-glucose dehydrogenase

X.species

XALc_1655 ugd-XALc_1655

1

449

S=1958 I=82 E=0

probable udp-glucose 6-dehydrogenase protein

X.species

NP_643888.1 ugd-XAC3581

1

361

S=392 I=32 E=2.70449e-40

UDP-glucose dehydrogenase

X.species

YP_365436.1 ugd2-XCV3705

1

361

S=387 I=32 E=1.28786e-39

UDP-glucose dehydrogenase

X.species

NP_637455.1 vipA-XCC2090

3

420

S=261 I=28 E=2.34145e-24

polysaccharide biosynthetic protein

X.species

XALc_1695 XALc_1695

2

372

S=228 I=27 E=2.19547e-20

probable polysaccharide biosynthesis protein

X.species

NP_642422.1 vipA-XAC2105

2

426

S=227 I=27 E=3.25028e-20

polysaccharide biosynthetic protein

X.species

YP_364148.1 XCV2417

2

426

S=218 I=27 E=4.07387e-19

UDP-glucose/GDP-mannose dehydrogenase

pubmed

1

346

S=1568 I=86 E=0

UDP-glucose dehydrogenase

Pubmed 7857269

 

prodomImg

pubmed

1

447

S=1540 I=64 E=9.00439e-178

UDP-glucose dehydrogenase

Pubmed 16404571

 

prodomImg

pubmed

1

443

S=1402 I=62 E=4.6568e-161

Putative UDP-glucose dehydrogenase

Pubmed 10543742

 

prodomImg

pubmed

1

442

S=1262 I=53 E=4.75409e-144

Putative UDP-glucose dehydrogenase

Pubmed 11035722

 

prodomImg

pubmed

1

443

S=1066 I=50 E=2.73771e-120

Putative UDP glucose dehydrogenase ; Plasmid

Pubmed 15033235

 

prodomImg

sp

1

446

S=1151 I=53 E=8.56616e-131

UDP-glucose 6-dehydrogenase EC=1.1.1.22 ; NAD Oxidoreductase

 

prodomImg

sp

2

443

S=1049 I=47 E=2.39347e-118

UDP-glucose 6-dehydrogenase tuaD EC=1.1.1.22 ; Cell wall biogenesis/degradation Cytoplasm NAD Oxidoreductase Phosphoprotein Stress response

 

prodomImg

sp

1

443

S=985 I=47 E=1.11353e-110

UDP-glucose 6-dehydrogenase EC=1.1.1.22 ; Capsule biogenesis/degradation NAD Oxidoreductase

 

prodomImg

sp

1

443

S=950 I=43 E=2.28839e-106

UDP-glucose 6-dehydrogenase ywqF EC=1.1.1.22 ; Cell wall biogenesis/degradation Cytoplasm NAD Oxidoreductase Phosphoprotein

 

prodomImg

sp

1

442

S=838 I=37 E=7.80726e-93

UDP-glucose 6-dehydrogenase EC=1.1.1.22 ; NAD Oxidoreductase

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

1

210

NAD(P)-binding domain

Iprscan IPR013328 [G3DSA:1.10.1040.10]

211

302

Dehydrogenase, multihelical

Iprscan IPR014027 [G3DSA:3.40.50.1870]

305

439

UDP-glucose/GDP-mannose dehydrogenase, C-terminal

Iprscan [PTHR11374:SF3]

161

443

-

Iprscan IPR014028 [PTHR11374]

161

443

UDP-glucose/GDP-mannose dehydrogenase, dimerisation and substrate-binding domain

Iprscan IPR001732 [PF03721]

1

187

UDP-glucose/GDP-mannose dehydrogenase, N-terminal

Iprscan IPR014026 [PF00984]

204

298

UDP-glucose/GDP-mannose dehydrogenase, dimerisation

Iprscan IPR014027 [PF03720]

324

428

UDP-glucose/GDP-mannose dehydrogenase, C-terminal

Iprscan IPR017476 [TIGR03026]

1

424

Nucleotide sugar dehydrogenase

Iprscan [PS51257]

1

18

-

Iprscan [SignalP-NN(euk)]

1

16

-

PD001282

211

299

S=304 I=69 E=2.72243e-29

PDA1D9D5

377

443

S=225 I=59 E=8.99974e-20

PD102173

63

307

S=177 I=27 E=5.64117e-14

PD190504

59

130

S=169 I=52 E=6.71022e-13

PD398280

1

56

S=164 I=59 E=2.3143e-12

PD472071

141

210

S=160 I=49 E=6.53152e-12

PD102170

323

373

S=142 I=53 E=1.00836e-09

PDA33161

300

323

S=130 I=100 E=3.07556e-08

PDA0A7T9

214

304

S=129 I=31 E=3.82461e-08

PDA7Y9I6

62

147

S=129 I=36 E=4.17304e-08

Iprscan IPR016040 [SSF51735]

1

209

NAD(P)-binding domain

Iprscan IPR014027 [SSF52413]

308

439

UDP-glucose/GDP-mannose dehydrogenase, C-terminal

Iprscan IPR008927 [SSF48179]

203

298

6-phosphogluconate dehydrogenase, C-terminal-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one SgULUkaE)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

132 hits
swiss-prot

Swiss-Prot ncbi-blastp

59 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT1DlHO/XFF4834R_chr29620.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT1DlHO/XFF4834R_chr29620.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT1DlHO/XFF4834R_chr29620.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBT1DlHO/XFF4834R_chr29620.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.