Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr28750gyrAXFF4834R_chr28750DNA gyrase subunit A

gyrA XFF4834R_chr28750
XFF4834R_chr28740
XFF4834R_chr28740
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3035
XFF4834R_chr_3035
ID gyrA
AC XFF4834R_chr28750
LT XFF4834R_chr28750
OR XFF4834R_chr from 3311677 to 3314376 on strand -
DE DNA gyrase subunit A
IP DNA gyrase, subunit A; DNA topoisomerase, type IIA, central
CL 2 Information transfer
EC
GO InterPro
Biological Process: DNA metabolic process (GO:0006259)
Biological Process: DNA topological change (GO:0006265)
Cellular Component: chromosome (GO:0005694)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: DNA topoisomerase activity (GO:0003916)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: DNA topoisomerase (ATP-hydrolyzing) activity (GO:0003918)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101104)
MW 98966.4 Da
SQ 899 aa
 
........10........20........30........40........50
| | | | |
MAETAKEIIQVNLEDEMRKSYLDYAMSVIVGRALPDARDGLKPVHRRVLY
AMHELGAHSNKAYFKSARIVGDVIGKYHPHGDQSVYDTLVRMAQPFSLRY
MMVDGQGNFGSVDGDSAAAMRYTESRMSRLAHELMADIDKETVDFQPNYD
EKEQEPTVMPTRFPSLLVNGSAGIAVGMATNIPPHNLTEAINACIALIDT
PELDVEGLMEYIPGPDFPTAGIINGTAGIAAGYRTGRGRVRIRAKADVEV
ADNGREAIVVTEIPYQVNKARLIEKIAELVKEKKLEGISELRDESDKDGM
RIYIEVKRGESAEVVLNNLYQQTQMEAVFGINMVALIDGRPQLMNLKQML
EAFIRHRREVVTRRTIFELRKARARAHVLEGLTVALANIDEMIELIKNSA
NPQEARERMLAKTWQPGLVGALLGAAGAEASKPEDLPPGVGLIQGFYQLS
EVQASQILEMRLHRLTGLEQEKLTDEYKQLLGVIEGLIRILENPDVLLQV
IRDELINIREEYGDERRTEIRHSEEDLDILDLIAPEDVVVTLSHAGYAKR
QPVSAYRAQRRGGRGRSAAATKEEDFIDQLWLVNTHDTLLTFTSSGKVFW
LPVHQLPEAGSNARGRPIINWIPLESGERVQAVLPVREYADNRYVFFATR
NGTVKKTPLSEFAFRLARGKIAINLDEGDALVGVALTDGDRDVLLFASNG
KTVRFGESTVRSMGRTATGVRGIRLTKGEEVVSLIVAERAGGVEEEIEGD
EVDDVVEATDGGESAVIEVADDGNVAYILTATENGYGKRTPLTEYPRKGR
GTQGVIGIQTTERNGKLVRAVLLGATDEVLLISDGGTLVRTRGSEISRVG
RNTQGVTLIRLSKGEKLQAVERLDASLDDVDEGVDEASASVSETPPTDA
XFF4834R

XFF4834R_chr30570 lcl|parC-XFF4834R_chr30570

10

403

S=889 I=45 E=9.94668e-101

DNA topoisomerase IV, subunit A

XFF4834R

XFF4834R_chr30570 lcl|parC-XFF4834R_chr30570

432

685

S=152 I=28 E=2.05948e-11

DNA topoisomerase IV, subunit A

X.species

NP_641963.1 lcl|gyrA-XAC1631

1

899

S=4298 I=92 E=0

DNA gyrase subunit A

X.species

YP_363403.1 lcl|gyrA-XCV1672

1

897

S=4272 I=92 E=0

DNA gyrase subunit A

X.species

NP_636945.1 lcl|gyrA-XCC1574

1

899

S=4125 I=88 E=0

DNA gyrase subunit A

X.species

lcl|gyrA-XALc_1725

1

707

S=3210 I=85 E=0

probable dna gyrase, subunit a protein

X.species

lcl|gyrA-XALc_1725

710

877

S=530 I=71 E=1.35204e-56

probable dna gyrase, subunit a protein

X.species

lcl|gyrA-XALc_1725

644

731

S=128 I=40 E=5.52258e-08

probable dna gyrase, subunit a protein

X.species

lcl|parC-XALc_2012

10

405

S=917 I=47 E=1.7794e-103

probable dna topoisomerase iv subunit a protein

X.species

lcl|parC-XALc_2012

438

549

S=128 I=33 E=6.40491e-08

probable dna topoisomerase iv subunit a protein

X.species

YP_363228.1 lcl|parC-XCV1497

10

403

S=888 I=45 E=5.09743e-100

DNA topoisomerase IV subunit A

X.species

YP_363228.1 lcl|parC-XCV1497

432

685

S=153 I=29 E=5.44073e-11

DNA topoisomerase IV subunit A

pubmed

1

707

S=3206 I=85 E=0

DNA gyrase A ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 18268084

 

prodomImg

pubmed

710

877

S=530 I=71 E=5.55811e-55

DNA gyrase A ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 18268084

 

prodomImg

pubmed

644

731

S=128 I=40 E=2.25057e-06

DNA gyrase A ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 18268084

 

prodomImg

pubmed

1

736

S=2468 I=64 E=0

DNA gyrase ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 9449286

 

prodomImg

pubmed

778

898

S=301 I=50 E=2.8482e-27

DNA gyrase ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 9449286

 

prodomImg

pubmed

582

734

S=124 I=28 E=8.61814e-06

DNA gyrase ; ATP-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 9449286

 

prodomImg

pubmed

1

736

S=2428 I=63 E=0

DNA gyrase subunit A EC=5.99.1.3 ; ATP-binding DNA-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 7642123

 

prodomImg

pubmed

778

879

S=298 I=56 E=6.18827e-27

DNA gyrase subunit A EC=5.99.1.3 ; ATP-binding DNA-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 7642123

 

prodomImg

pubmed

582

734

S=123 I=29 E=9.08098e-06

DNA gyrase subunit A EC=5.99.1.3 ; ATP-binding DNA-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 7642123

 

prodomImg

pubmed

1

736

S=2413 I=62 E=0

DNA gyrase subunit A EC=5.99.1.3 ; ATP-binding DNA-binding Isomerase Nucleotide-binding Topoisomerase

Pubmed 8849216

 

prodomImg

Iprscan IPR013758 [G3DSA:3.90.199.10]

30

296

DNA topoisomerase, type IIA, subunit A or C-terminal, alpha-beta

Iprscan IPR013757 [G3DSA:1.10.268.10]

369

492

DNA topoisomerase, type IIA, subunit A, alpha-helical

Iprscan IPR002205 [PF00521]

32

513

DNA topoisomerase, type IIA, subunit A or C-terminal

Iprscan IPR006691 [PF03989]

536

585

DNA gyrase/topoisomerase IV, subunit A, C-terminal beta-pinwheel

Iprscan IPR006691 [PF03989]

586

638

DNA gyrase/topoisomerase IV, subunit A, C-terminal beta-pinwheel

Iprscan IPR006691 [PF03989]

642

689

DNA gyrase/topoisomerase IV, subunit A, C-terminal beta-pinwheel

Iprscan IPR006691 [PF03989]

690

739

DNA gyrase/topoisomerase IV, subunit A, C-terminal beta-pinwheel

Iprscan IPR006691 [PF03989]

775

825

DNA gyrase/topoisomerase IV, subunit A, C-terminal beta-pinwheel

Iprscan IPR006691 [PF03989]

826

875

DNA gyrase/topoisomerase IV, subunit A, C-terminal beta-pinwheel

Iprscan IPR002205 [SM00434]

11

498

DNA topoisomerase, type IIA, subunit A or C-terminal

Iprscan IPR005743 [TIGR01063]

8

875

DNA gyrase, subunit A

Iprscan [seg]

219

232

-

Iprscan [seg]

417

428

-

Iprscan [seg]

555

570

-

Iprscan [seg]

741

763

-

PD874064

186

315

S=397 I=61 E=2.07931e-40

PD491907

110

186

S=317 I=74 E=8.04174e-31

PD699864

7

68

S=253 I=77 E=4.85979e-23

PD000742

69

127

S=221 I=70 E=4.17634e-19

PD701689

316

369

S=197 I=64 E=3.43879e-16

PD254467

643

696

S=172 I=63 E=3.6144e-13

PD488062

368

414

S=152 I=57 E=9.3334e-11

PD488062

441

487

S=117 I=53 E=1.69769e-06

PD695806

589

634

S=143 I=54 E=1.06286e-09

PDA5N243

777

878

S=128 I=28 E=6.34374e-08

PD490970

786

828

S=117 I=59 E=1.77333e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ME8SeJoJ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

291 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBj55hW9/XFF4834R_chr28750.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBj55hW9/XFF4834R_chr28750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBj55hW9/XFF4834R_chr28750.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBj55hW9/XFF4834R_chr28750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.