Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr28740XFF4834R_chr31310982_3311501_r2_XFF4834R-XFF4834R_chr28740XFF4834R_chr28740putative PQQ-dependent dehydrogenase

XFF4834R_chr31310982_3311501_r2_XFF4834R-XFF4834R_chr28740 XFF4834R_chr28740
XFF4834R_chr_3032
XFF4834R_chr_3032
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr28750
XFF4834R_chr28750
ID XFF4834R_chr31310982_3311501_r2_XFF4834R-XFF4834R_chr28740
AC XFF4834R_chr28740
LT XFF4834R_chr28740
OR XFF4834R_chr from 3308982 to 3311450 on strand -
DE putative PQQ-dependent dehydrogenase
IP Quinonprotein alcohol dehydrogenase-like; PQQ-dependent membrane bound dehydrogenase, glucose/quinate/shikimate related; PQQ-dependent dehydrogenase, methanol/ethanol family
CL 1.1.5 Others
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: quinone binding (GO:0048038)
acting on CH-OH group of donors (GO:0016614)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 87904.1 Da
SQ 822 aa
 
........10........20........30........40........50
| | | | |
MTILDRPSGRGHWALATLGGVIALLGAVLLAGGVWLAALGGSWYYAPAGA
AMLVAGVLLFRGRNAGAWWFAGVVAVSLLWTWWESGSDYWRWVPRLGLIV
GLALVLALLLPKLQRPVSRTVSRSLAGALAVVFVVAFALAFMPHGVTEAD
GALAHAAGVLGGLVNRDASAPVAASGAQPANAPADGDWAAYGRSQAGQRY
SPLQQINRDNVAQLQQAWLFHTGDLPNKRWGAETTPLKVGDSLYLCTARN
QVIALDAASGKQRWRYDPKVKDEAIPYTAACRGVSYYEVPAAANAADAGV
TAALCRTRVIEGTLDGRLIALDARSGTPCPDFGSNGQVDITVGMGETPPG
YVSINSPPAIVRGVVVTGHQVLDGQKRYEPSGVIEGFDAVTGKLRWAWDM
THPEWNGAPPPGQSWTRGTPNMWTTAAADEQLGYVYLPMGNSTADYWSSS
RTPQENRYATSLVALDVATGKPVWNFQTTHIDAWDYDLGSQPSLIDFPKD
GVNVPAVLLPSKQGELYVLDRRTGKPLVGVEERTVPGGGVEPQMRAKTQP
FSLYHTLRKPDLTERDMWGMTPIDQLVCRIQFRKASYKGIYTPPEADRHS
IEYPGYNGGSDWGSVAVDPHRGVIVANYNDMPNYNLLVPRAKADKLGWAP
RDEVRGDAGGAEGAGDPQAGTPYAINVNAGWRLPFTKLLCKEPPYGGIRA
IELASGKTLWDRPFGSARGNGPFGIRSGLPIDIGTPNNGGAVVTASGLIF
IAAATDDLIRAIDLATGKELWHAKLPAGGQANPMVYEYGGREYLVIMAGG
HHFMETPAGDAVIAYALPQKTQ
XFF4834R

XFF4834R_chr14150 lcl|gcd-XFF4834R_chr14150

187

822

S=1356 I=44 E=2.71554e-157

glucose dehydrogenase

XFF4834R

XFF4834R_chr06570 lcl|XFF4834R_chr06830099_0750129_f1_XFF4834R-XFF4834R_chr06570

187

527

S=284 I=31 E=2.11897e-27

XFF4834R

XFF4834R_chr06570 lcl|XFF4834R_chr06830099_0750129_f1_XFF4834R-XFF4834R_chr06570

740

799

S=126 I=42 E=2.59356e-08

X.species

YP_363404.1 lcl|gcd1-XCV1673

1

822

S=3411 I=81 E=0

glucose dehydrogenase

X.species

NP_636946.1 lcl|gcd-XCC1575

1

820

S=3225 I=76 E=0

glucose dehydrogenase

X.species

NP_641965.1 lcl|gcd-XAC1633

185

822

S=3168 I=94 E=0

glucose dehydrogenase

X.species

NP_638430.1 lcl|gcd-XCC3083

187

818

S=1361 I=45 E=2.43133e-157

glucose dehydrogenase

X.species

YP_365068.1 lcl|gcd2-XCV3337

187

822

S=1357 I=44 E=6.80224e-157

glucose dehydrogenase

X.species

NP_643520.1 lcl|gcd-XAC3212

187

822

S=1355 I=44 E=1.21997e-156

glucose dehydrogenase

X.species

YP_362439.1 lcl|mxaF-XCV0708

187

527

S=285 I=31 E=4.95026e-27

methanol dehydrogenase heavy chain (fragment)

X.species

NP_641001.1 lcl|mxaF-XAC0648

187

527

S=281 I=31 E=1.63448e-26

methanol dehydrogenase heavy chain

X.species

NP_641001.1 lcl|mxaF-XAC0648

740

799

S=126 I=42 E=1.08666e-07

methanol dehydrogenase heavy chain

X.species

NP_638828.1 lcl|mxaF-XCC3482

187

527

S=276 I=29 E=6.53783e-26

methanol dehydrogenase heavy chain

X.species

YP_362440.1 lcl|mxaF-XCV0709

740

799

S=123 I=42 E=2.38167e-07

methanol dehydrogenase heavy chain (fragment)

pubmed

186

822

S=1724 I=52 E=0

Glycerol dehydrogenase large subunit EC=1.1.99.22 ; Oxidoreductase Secreted Signal

Pubmed 12686146,12676670

 

prodomImg

pubmed

186

818

S=1688 I=52 E=0

Glycerol dehydrogenase large subunit EC=1.1.99.22 ; Oxidoreductase Secreted Signal

Pubmed 15060755

 

prodomImg

pubmed

186

822

S=1675 I=51 E=0

Large subunit of glycerol dehydrogenase

Pubmed 18323643

 

prodomImg

pubmed

185

822

S=1259 I=41 E=2.06175e-143

Quinoprotein glucose dehydrogenase EC=1.1.5.2 ; Cell inner membrane Oxidoreductase PQQ Transmembrane

Pubmed 2228962,8419307

 

prodomImg

pubmed

185

818

S=1209 I=40 E=2.50697e-137

Quinoprotein glucose dehydrogenase A EC=1.1.5.2 ; Cell inner membrane Oxidoreductase PQQ Signal Transmembrane

Pubmed 3399393

 

prodomImg

sp

186

822

S=1724 I=52 E=0

Glycerol dehydrogenase large subunit EC=1.1.99.22 ; Oxidoreductase Secreted Signal

 

prodomImg

sp

186

818

S=1688 I=52 E=0

Glycerol dehydrogenase large subunit EC=1.1.99.22 ; Oxidoreductase Secreted Signal

 

prodomImg

sp

185

822

S=1259 I=41 E=1.40403e-143

Quinoprotein glucose dehydrogenase EC=1.1.5.2 ; Cell inner membrane Oxidoreductase PQQ Transmembrane

 

prodomImg

sp

185

818

S=1209 I=40 E=1.70722e-137

Quinoprotein glucose dehydrogenase A EC=1.1.5.2 ; Cell inner membrane Oxidoreductase PQQ Signal Transmembrane

 

prodomImg

sp

187

819

S=1125 I=39 E=2.71103e-127

Quinate/shikimate dehydrogenase [Pyrroloquinoline-quinone] EC=1.1.99.25 ; Cell membrane Oxidoreductase PQQ metabolism Transmembrane

 

prodomImg

Iprscan IPR011047 [G3DSA:2.140.10.10]

173

817

Quinonprotein alcohol dehydrogenase-like

Iprscan IPR002372 [PF01011]

243

276

Pyrrolo-quinoline quinone repeat

Iprscan IPR002372 [PF01011]

458

487

Pyrrolo-quinoline quinone repeat

Iprscan IPR002372 [PF01011]

759

784

Pyrrolo-quinoline quinone repeat

Iprscan IPR019551 [PF10527]

185

226

PQQ-dependent enzyme, N-terminal

Iprscan IPR019556 [PF10535]

423

443

PQQ-dependent enzyme, C-terminal

Iprscan IPR018391 [SM00564]

236

267

Pyrrolo-quinoline quinone beta-propeller repeat

Iprscan IPR018391 [SM00564]

302

343

Pyrrolo-quinoline quinone beta-propeller repeat

Iprscan IPR018391 [SM00564]

358

399

Pyrrolo-quinoline quinone beta-propeller repeat

Iprscan IPR018391 [SM00564]

440

477

Pyrrolo-quinoline quinone beta-propeller repeat

Iprscan IPR018391 [SM00564]

741

774

Pyrrolo-quinoline quinone beta-propeller repeat

Iprscan IPR017511 [TIGR03074]

16

818

PQQ-dependent membrane bound dehydrogenase, glucose/quinate/shikimate related

Iprscan [seg]

14

41

-

Iprscan [seg]

46

59

-

Iprscan [seg]

65

76

-

Iprscan [seg]

96

110

-

Iprscan [seg]

125

141

-

Iprscan [seg]

151

164

-

Iprscan [seg]

168

184

-

Iprscan [seg]

291

303

-

Iprscan [seg]

656

670

-

Iprscan [SignalP-NN(euk)]

1

36

-

Iprscan [tmhmm]

12

34

-

Iprscan [tmhmm]

38

60

-

Iprscan [tmhmm]

65

82

-

Iprscan [tmhmm]

92

111

-

Iprscan [tmhmm]

124

146

-

PD003220

391

536

S=290 I=46 E=1.45909e-27

PD703840

530

645

S=268 I=51 E=6.87628e-25

PD014146

305

389

S=201 I=51 E=8.64346e-17

PDA4D5L3

734

776

S=167 I=74 E=1.35561e-12

PD645651

80

148

S=161 I=46 E=6.5689e-12

PDA1R9M7

633

683

S=154 I=61 E=4.28145e-11

PDA8Q5T3

369

421

S=153 I=53 E=5.70881e-11

PD013214

185

221

S=137 I=65 E=5.31531e-09

PDA1G241

777

818

S=115 I=62 E=2.41911e-06

PD858570

688

736

S=110 I=47 E=1.03753e-05

Iprscan IPR011047 [SSF50998]

180

818

Quinonprotein alcohol dehydrogenase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VhYgGoFN)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

79 hits
swiss-prot

Swiss-Prot ncbi-blastp

21 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

28 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2880cR/XFF4834R_chr28740.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2880cR/XFF4834R_chr28740.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2880cR/XFF4834R_chr28740.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB2880cR/XFF4834R_chr28740.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.