Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr28450XFF4834R_chr30980202_3277404_f1_XFF4834R-XFF4834R_chr28450XFF4834R_chr28450probable FAD dependent oxidoreductase

XFF4834R_chr30980202_3277404_f1_XFF4834R-XFF4834R_chr28450 XFF4834R_chr28450
XFF4834R_chr28440
XFF4834R_chr28440
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr28460
XFF4834R_chr28460
ID XFF4834R_chr30980202_3277404_f1_XFF4834R-XFF4834R_chr28450
AC XFF4834R_chr28450
LT XFF4834R_chr28450
OR XFF4834R_chr from 3276202 to 3277404 on strand +
DE probable FAD dependent oxidoreductase
IP FAD dependent oxidoreductase
CL 1.4.3 Electron carrier GO:0009055
EC
GO InterPro
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [CH] Energy production and conversion;Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100510)
MW 43696.6 Da
SQ 400 aa
 
........10........20........30........40........50
| | | | |
MPRRILITGASIAGNTAAWTLAHRGFDVTVAERATRFRDGGQNIDVRGVG
REVLQRMGLERAALAQGTGEEGTAWIDAHGQAVATFKTEDVDDDGPTAEL
EILRGDLARLLYDAARSHVTYRFGDRIASIEDAAGSDAATVTFESGCSER
FDAVIVAEGVGSSTREQVFPGENDPRWMDLTIAYFTIPRSADDDRLWRWY
HTTGGRSISLRPDRHGTTRAMLSLQKPPEGEQDWSVDAQKAYLHERFADA
GWQAARVLDGMHGTDDFYFDALRQVRMQRWHSGRTVLTGDAAWCATPLAG
IGATLAVTGAYVLANEIAQADTLDAAFAAFAAVRHRHCARLVEQAQGVPK
IGPRLMNPHSRLGIHLLHGALKLASQPSVQNLAAKWMTPAIKAPDLSRYP
XFF4834R

XFF4834R_chr22510 lcl|XFF4834R_chr_2593893_2595083_f3_XFF4834R-XFF4834R_chr22510

1

399

S=964 I=49 E=3.40734e-110

XFF4834R

XFF4834R_chr31630 lcl|XFF4834R_chr34190819_3634090_r3_XFF4834R-XFF4834R_chr31630

4

339

S=122 I=26 E=3.95966e-08

XFF4834R

XFF4834R_chr22510 lcl|XFF4834R_chr_2593893_2595083_f3_XFF4834R-XFF4834R_chr22510

1

399

S=964 I=49 E=3.40734e-110

XFF4834R

XFF4834R_chr31630 lcl|XFF4834R_chr34190819_3634090_r3_XFF4834R-XFF4834R_chr31630

4

339

S=122 I=26 E=3.95966e-08

X.species

NP_641998.2 lcl|XAC1667-XAC1667

1

400

S=1968 I=95 E=0

oxidoreductase

X.species

YP_363434.1 lcl|XCV1703

1

400

S=1907 I=93 E=0

putative FAD-dependent oxidoreductase

X.species

NP_642450.1 lcl|XAC2133-XAC2133

242

399

S=364 I=44 E=7.32067e-37

oxidoreductase

X.species

NP_636661.1 lcl|XCC1287

4

339

S=140 I=26 E=8.82337e-10

oxidoreductase

X.species

NP_641673.1 lcl|XAC1338-XAC1338

4

339

S=126 I=26 E=4.08975e-08

oxidoreductase

X.species

YP_363121.1 lcl|XCV1390

4

339

S=124 I=27 E=8.35969e-08

putative monooxygenase

pubmed

1

382

S=1018 I=54 E=1.57455e-114

Oxidoreductase

Pubmed 16957231

 

prodomImg

pubmed

5

399

S=707 I=41 E=7.26978e-77

Putative oxidoreductase

Pubmed 15257441

 

prodomImg

pubmed

3

397

S=567 I=38 E=5.81407e-60

Oxidoreductase protein homolog Oxi ; Plasmid

Pubmed 11078655

 

prodomImg

pubmed

3

375

S=432 I=33 E=1.60504e-43

Oxidoreductase

Pubmed 17462021,17660442

 

prodomImg

pubmed

20

317

S=156 I=25 E=4.10978e-10

Putative oxidoreductase yetM EC=1.-.-.- ; FAD Flavoprotein Signal

Pubmed 9141694

 

prodomImg

pubmed

2

318

S=146 I=24 E=5.57164e-09

Zeaxanthin epoxidase

Pubmed 12671093

 

prodomImg

pubmed

4

324

S=146 I=26 E=7.23733e-09

Putative monooxygenase

Pubmed 15271354

 

prodomImg

pubmed

239

317

S=144 I=40 E=1.0903e-08

Putative monooxygenase

Pubmed 19000034

 

prodomImg

pubmed

4

320

S=124 I=26 E=3.23692e-06

Zeaxanthin epoxidase

Pubmed 12671093

 

prodomImg

sp

3

320

S=490 I=38 E=9.25224e-51

Uncharacterized protein Rv1260/MT1298

 

prodomImg

sp

20

317

S=156 I=25 E=2.82852e-10

Putative oxidoreductase yetM EC=1.-.-.- ; FAD Flavoprotein Signal

 

prodomImg

sp

3

324

S=132 I=26 E=2.04348e-07

Kynurenine 3-monooxygenase EC=1.14.13.9 ; FAD Flavoprotein NADP Oxidoreductase Pyridine nucleotide biosynthesis

 

prodomImg

PD115443

178

270

S=308 I=63 E=6.78028e-30

PD631568

348

399

S=198 I=67 E=1.61797e-16

PDA126O9

44

103

S=145 I=52 E=4.74592e-10

PDA1K7G0

1

43

S=138 I=67 E=2.85983e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0460QUBH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

9 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzm8Qg5/XFF4834R_chr28450.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzm8Qg5/XFF4834R_chr28450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzm8Qg5/XFF4834R_chr28450.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzm8Qg5/XFF4834R_chr28450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.