Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr28440XFF4834R_chr_3275701_3276165_f1_XFF4834R-XFF4834R_chr28440XFF4834R_chr28440putative MarR family transcriptional regulator

XFF4834R_chr_3275701_3276165_f1_XFF4834R-XFF4834R_chr28440 XFF4834R_chr28440
XFF4834R_chr_2999
XFF4834R_chr_2999
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr28450
XFF4834R_chr28450
ID XFF4834R_chr_3275701_3276165_f1_XFF4834R-XFF4834R_chr28440
AC XFF4834R_chr28440
LT XFF4834R_chr28440
OR XFF4834R_chr from 3275701 to 3276165 on strand +
DE putative MarR family transcriptional regulator
IP HTH transcriptional regulator, MarR
CL 3.1.2 Transcriptional level GO:0006355
EC
GO InterPro
Cellular Component: intracellular (GO:0005622)
DNA-dependent (GO:0006355)
Molecular Function: transcription factor activity (GO:0003700)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120315)
MW 16746.6 Da
SQ 154 aa
 
........10........20........30........40........50
| | | | |
MLDQNELIHPQAAVAPGYLANHAARVFNRLVDARLRPHGVSLALIGPIML
LSWKGPMLQRDLVIASAVKQPAMVALLDKLEALKLIKRTPTPQDRRAALV
ALTARGRKIAELGGQALLGMNAVALEGFSTDEVQQTVALMHRLIANMERH
GQDV
XFF4834R

XFF4834R_chr41730 lcl|slyA-XFF4834R_chr41730

8

109

S=115 I=33 E=7.14139e-08

DNA-binding transcriptional activator

XFF4834R

XFF4834R_chr30550 lcl|XFF4834R_chr33200235_3511675_r3_XFF4834R-XFF4834R_chr30550

48

106

S=93 I=37 E=3.42475e-05

X.species

NP_641999.1 lcl|slyA-XAC1668

1

154

S=771 I=98 E=8.22126e-87

transcriptional regulator for cryptic hemolysin

X.species

YP_363435.1 lcl|XCV1704

1

154

S=738 I=94 E=9.01861e-83

MarR family transcriptional regulator

X.species

NP_644597.1 lcl|slyA-XAC4303

8

109

S=115 I=33 E=2.70112e-07

transcriptional regulator for cryptic hemolysin

X.species

NP_639501.1 lcl|slyA-XCC4167

10

109

S=114 I=33 E=3.10547e-07

transcriptional regulator for cryptic hemolysin

X.species

YP_366134.1 lcl|XCV4403

8

109

S=111 I=33 E=7.96289e-07

MarR family transcriptional regulator

pubmed

8

148

S=419 I=67 E=1.25036e-42

Transcriptional regulator ; DNA-binding regulation

Pubmed 16957231

 

prodomImg

pubmed

17

147

S=169 I=31 E=2.32464e-12

Probable transcriptional regulator ; DNA-binding regulation

Pubmed 15329493

 

prodomImg

pubmed

24

153

S=119 I=27 E=2.72975e-06

Putative transcriptional regulator ; DNA-binding regulation

Pubmed 16332749

 

prodomImg

pubmed

25

153

S=115 I=31 E=7.70401e-06

Transcriptional regulator slyA ; Activator DNA-binding Repressor regulation Virulence

Pubmed 10385201

 

prodomImg

pubmed

25

153

S=115 I=31 E=7.70401e-06

Transcriptional regulator slyA ; Activator DNA-binding Repressor regulation Virulence

Pubmed 10385201

 

prodomImg

pubmed

25

147

S=114 I=31 E=9.74883e-06

Transcriptional regulator slyA ; Activator DNA-binding Repressor regulation Virulence

Pubmed 11580832

 

prodomImg

pubmed

25

153

S=114 I=31 E=9.8342e-06

Transcriptional regulator slyA ; Activator DNA-binding Repressor regulation Virulence

Pubmed 8290552

 

prodomImg

pubmed

25

147

S=112 I=30 E=1.94127e-05

Transcriptional regulator slyA ; Activator DNA-binding Repressor regulation Virulence

Pubmed 10672189,12761136

 

prodomImg

pubmed

25

147

S=112 I=29 E=2.06344e-05

Transcriptional regulator slyA ; Activator DNA-binding Repressor regulation Virulence

Pubmed 8544813,8861216

 

prodomImg

pubmed

25

147

S=111 I=32 E=2.17426e-05

Transcriptional regulator slyA ; Activator Antibiotic biosynthesis DNA-binding Repressor regulation

Pubmed 12147472

 

prodomImg

sp

25

147

S=120 I=33 E=1.32395e-06

Transcriptional regulator slyA ; Activator DNA-binding Repressor regulation

 

prodomImg

sp

24

147

S=116 I=34 E=3.97165e-06

Transcriptional regulator slyA ; Activator DNA-binding Repressor regulation

 

prodomImg

sp

25

153

S=115 I=31 E=5.38888e-06

Transcriptional regulator slyA ; Activator DNA-binding Repressor regulation Virulence

 

prodomImg

sp

25

153

S=115 I=31 E=5.38888e-06

Transcriptional regulator slyA ; Activator DNA-binding Repressor regulation

 

prodomImg

sp

25

153

S=115 I=31 E=5.38888e-06

Transcriptional regulator slyA ; Activator DNA-binding Repressor regulation Virulence

 

prodomImg

Iprscan IPR011991 [G3DSA:1.10.10.10]

40

111

Winged helix repressor DNA-binding

Iprscan IPR000835 [PF01047]

40

109

HTH transcriptional regulator, MarR

Iprscan IPR000835 [SM00347]

33

133

HTH transcriptional regulator, MarR

Iprscan IPR000835 [PS50995]

1

145

HTH transcriptional regulator, MarR

PDA2X396

34

89

S=267 I=96 E=6.66958e-25

PD612122

8

33

S=132 I=96 E=1.51985e-08

PDA6T2W6

90

148

S=109 I=44 E=1.00634e-05

PD643667

68

150

S=106 I=26 E=1.90178e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9MIQveZ5)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

11 hits
swiss-prot

Swiss-Prot ncbi-blastp

25 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBleIAIP/XFF4834R_chr28440.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBleIAIP/XFF4834R_chr28440.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBleIAIP/XFF4834R_chr28440.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBleIAIP/XFF4834R_chr28440.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.