Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr27710recAXFF4834R_chr27710Recombinase A

recA XFF4834R_chr27710
XFF4834R_chr27700
XFF4834R_chr27700
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27720
XFF4834R_chr27720
ID recA
AC XFF4834R_chr27710
LT XFF4834R_chr27710
OR XFF4834R_chr from 3199814 to 3200848 on strand -
DE Recombinase A
IP DNA recombination and repair protein RecA; DNA recombination and repair protein RecA, conserved site; DNA recombination and repair protein RecA/RadB, ATP-binding domain
CL 2.1 DNA related GO:0006259
EC
GO InterPro
Biological Process: DNA metabolic process (GO:0006259)
Molecular Function: nucleotide binding (GO:0000166)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)
Molecular Function: DNA-dependent ATPase activity (GO:0008094)
Molecular Function: ATP binding (GO:0005524)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101104)
MW 37176.4 Da
SQ 344 aa
 
........10........20........30........40........50
| | | | |
MDENKKRALSAALSQIEKQFGKGSVMRMGDRVIEAVEVIPTGSLMLDIAL
GIGGLPKGRVVEIYGPESSGKTTLTLQAIAECQKNGGTAAFIDAEHALDP
IYAAKLGVNVDDLLLSQPDTGEQALEIADMLVRSGSVDIVVVDSVAALTP
KAEIEGEMGDQLPGLQARLMSQALRKLTGNIKRSNTLVVFINQLRMKIGV
MMPGQSPEVTTGGNALKFYASVRLDIRRIGAIKKGDEIIGNQTKIKVVKN
KLAPPFKQVVTEILYGEGISREGELIDMGVEAKLVDKAGAWYSYGDERIG
QGKDNARTYLRDNPQVATRLEAELREKFQPAEAPREAGDDEDKE
Hamap RECA_MF_00268 raw_score=11120 norm_score=50.727

Protein recA [recA].

X.species

YP_363504.1 lcl|recA-XCV1773

1

344

S=1694 I=96 E=0

recombinase A

X.species

NP_642071.1 lcl|recA-XAC1740

1

344

S=1690 I=96 E=0

recombinase A

X.species

NP_637092.1 lcl|recA-XCC1722

1

343

S=1649 I=93 E=0

recombinase A

X.species

lcl|recA-XALc_1171

1

344

S=1599 I=90 E=0

probable protein reca (recombinase a).

pubmed

1

344

S=1665 I=94 E=0

Protein recA ; ATP-binding Cytoplasm DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

Pubmed 9465392,12007798

 

prodomImg

pubmed

1

343

S=1649 I=93 E=0

Protein recA ; ATP-binding Cytoplasm DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

Pubmed 8619877,12007798

 

prodomImg

pubmed

1

342

S=1263 I=71 E=2.42169e-144

Protein recA ; ATP-binding DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

Pubmed 18194518

 

prodomImg

pubmed

1

342

S=1260 I=71 E=5.94467e-144

Protein recA ; ATP-binding Cytoplasm DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

Pubmed 2121588,11251842

 

prodomImg

pubmed

8

341

S=1245 I=72 E=3.16792e-142

Protein recA ; ATP-binding DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

Pubmed 16000805

 

prodomImg

pubmed

1

344

S=1242 I=68 E=8.6342e-142

Protein recA ; ATP-binding Cytoplasm DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

Pubmed 7934905

 

prodomImg

pubmed

8

341

S=1240 I=71 E=1.4442e-141

Protein recA ; ATP-binding DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

Pubmed 16000805

 

prodomImg

pubmed

8

341

S=1240 I=71 E=1.4442e-141

Protein recA ; ATP-binding DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

Pubmed 19167363

 

prodomImg

pubmed

8

341

S=1240 I=71 E=1.58956e-141

Protein recA ; ATP-binding DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

Pubmed 16000805

 

prodomImg

pubmed

8

341

S=1239 I=71 E=1.89238e-141

Protein recA ; ATP-binding DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

Pubmed 16000805

 

prodomImg

sp

1

344

S=1694 I=96 E=0

Protein recA ; ATP-binding Cytoplasm DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

 

prodomImg

sp

1

344

S=1690 I=96 E=0

Protein recA ; ATP-binding Cytoplasm DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

 

prodomImg

sp

1

344

S=1690 I=96 E=0

Protein recA ; ATP-binding Cytoplasm DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

 

prodomImg

sp

1

344

S=1665 I=94 E=0

Protein recA ; ATP-binding Cytoplasm DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

 

prodomImg

sp

1

344

S=1665 I=94 E=0

Protein recA ; ATP-binding Cytoplasm DNA damage recombination repair DNA-binding Nucleotide-binding SOS response

 

prodomImg

Iprscan [G3DSA:3.40.50.300]

26

270

-

Iprscan [G3DSA:3.30.250.10]

271

329

-

Iprscan IPR013765 [MF_00268]

4

331

DNA recombination and repair protein RecA

Iprscan IPR013765 [PF00154]

7

330

DNA recombination and repair protein RecA

Iprscan IPR003593 [SM00382]

57

230

ATPase, AAA+ type, core

Iprscan IPR013765 [TIGR02012]

4

326

DNA recombination and repair protein RecA

Iprscan IPR020584 [PS00321]

215

223

DNA recombination/repair protein RecA, conserved site

Iprscan IPR020588 [PS50162]

35

198

DNA recombination/repair protein RecA/RadB, ATP-binding domain

Iprscan IPR020587 [PS50163]

199

274

DNA recombination/repair protein RecA, monomer-monomer interface

Iprscan [seg]

132

145

-

PD493955

207

276

S=303 I=80 E=3.0269e-29

PD103312

75

116

S=181 I=83 E=1.86675e-14

PD000229

156

201

S=180 I=80 E=2.38292e-14

PDA92753

37

131

S=169 I=42 E=5.31012e-13

PD492971

277

320

S=153 I=55 E=4.7332e-11

PDA9E368

37

266

S=134 I=26 E=8.92985e-09

PD007172

34

76

S=131 I=65 E=2.02663e-08

PD741946

1

30

S=128 I=80 E=4.48072e-08

PD858124

44

100

S=126 I=47 E=8.24903e-08

PDA1Y8Y7

321

344

S=117 I=100 E=9.89821e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Al1kOOvV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhWn_3p/XFF4834R_chr27710.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhWn_3p/XFF4834R_chr27710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhWn_3p/XFF4834R_chr27710.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhWn_3p/XFF4834R_chr27710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.