Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr27700recXXFF4834R_chr27700probable regulatory protein Recx

recX XFF4834R_chr27700
XFF4834R_chr27690
XFF4834R_chr27690
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27710
XFF4834R_chr27710
ID recX
AC XFF4834R_chr27700
LT XFF4834R_chr27700
OR XFF4834R_chr from 3199028 to 3199516 on strand -
DE probable regulatory protein Recx
IP Regulatory protein RecX
CL 3.1.4 Regulation level unknown
EC
GO InterPro
Biological Process: regulation of DNA repair (GO:0006282)

Curated
PM
AN regulatory protein for RecA
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100930)
MW 18156 Da
SQ 162 aa
 
........10........20........30........40........50
| | | | |
MDEQEPAPKRGRRFKEQTPVQRALGLLVRREHSRKELNRKLLARGIEPDA
AQAAVDRLTDEGWQDDTRFAAAVVRNRAGSGYGPLHIRAELGTHGLDSEA
ISAALATFEGDWTENARDLIRRRFGEQGPTDLPQRRKAADLLARRGFDGN
SVRAATRFDLED
Show or not Domain decomposition
 
Hamap RECX_MF_01114 raw_score=1646 norm_score=14.125

Regulatory protein recX [recX].

X.species

YP_363505.1 lcl|recX-XCV1774

1

162

S=818 I=99 E=1.62906e-92

recombination regulator RecX

X.species

NP_642072.1 lcl|recX-XAC1741

1

162

S=813 I=98 E=7.10978e-92

recombination regulator RecX

X.species

NP_637093.1 lcl|recX-XCC1723

1

162

S=735 I=88 E=2.15409e-82

recombination regulator RecX

X.species

lcl|recX-XALc_1172

4

162

S=565 I=71 E=7.83406e-62

probable regulatory protein recx

pubmed

1

162

S=813 I=98 E=2.36512e-90

Regulatory protein recX ; Cytoplasm

Pubmed 11178726

 

prodomImg

pubmed

1

162

S=786 I=94 E=5.12583e-87

Regulatory protein recX ; Cytoplasm

Pubmed 11728720,12007798

 

prodomImg

pubmed

1

162

S=735 I=88 E=7.16575e-81

Regulatory protein recX ; Cytoplasm

Pubmed 12007798

 

prodomImg

pubmed

23

152

S=236 I=42 E=1.73244e-20

Regulatory protein recX ; Cytoplasm

Pubmed 8165147

 

prodomImg

pubmed

23

162

S=236 I=41 E=2.21146e-20

Regulatory protein recX ; Cytoplasm

Pubmed 11053404

 

prodomImg

pubmed

18

152

S=229 I=41 E=1.23203e-19

Regulatory protein recX ; Cytoplasm

Pubmed 8468303

 

prodomImg

pubmed

18

131

S=227 I=45 E=2.74776e-19

Regulatory protein recX ; Cytoplasm

Pubmed 8294013,8165147

 

prodomImg

pubmed

23

152

S=195 I=35 E=2.01837e-15

Regulatory protein recX ; Cytoplasm

Pubmed 11251842,2121588

 

prodomImg

pubmed

20

147

S=184 I=36 E=4.0158e-14

Regulatory protein recX ; Cytoplasm DNA damage repair SOS response

Pubmed 7512687

 

prodomImg

pubmed

22

155

S=162 I=37 E=1.97687e-11

Regulatory protein recX ; Cytoplasm

Pubmed 12718403

 

prodomImg

sp

1

162

S=818 I=99 E=3.7779e-91

Regulatory protein recX ; Cytoplasm

 

prodomImg

sp

1

162

S=813 I=98 E=1.64881e-90

Regulatory protein recX ; Cytoplasm

 

prodomImg

sp

1

162

S=813 I=98 E=1.64881e-90

Regulatory protein recX ; Cytoplasm

 

prodomImg

sp

1

162

S=786 I=94 E=3.5734e-87

Regulatory protein recX ; Cytoplasm

 

prodomImg

sp

1

162

S=786 I=94 E=3.5734e-87

Regulatory protein recX ; Cytoplasm

 

prodomImg

Iprscan [MF_01114]

11

162

-

Iprscan IPR003783 [PF02631]

41

161

Regulatory protein RecX

PDA1R7B5

1

32

S=163 I=100 E=2.58371e-12

PD013331

27

74

S=118 I=52 E=6.83154e-07

PD009152

74

153

S=117 I=42 E=1.01137e-06

PD760457

2

80

S=110 I=42 E=7.19241e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1Nscc4Ci)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

16 hits
swiss-prot

Swiss-Prot ncbi-blastp

141 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVanxO_/XFF4834R_chr27700.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVanxO_/XFF4834R_chr27700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVanxO_/XFF4834R_chr27700.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVanxO_/XFF4834R_chr27700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.