Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr27400XFF4834R_chr27400XFF4834R_chr27400putative beta-galactosidase

XFF4834R_chr27400 XFF4834R_chr27400
XFF4834R_chr27390
XFF4834R_chr27390
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27410
XFF4834R_chr27410
ID XFF4834R_chr27400
AC XFF4834R_chr27400
LT XFF4834R_chr27400
OR XFF4834R_chr from 3163687 to 3165429 on strand -
DE putative beta-galactosidase
IP
CL 1.2.4 Polysaccharides GO:0000272
EC
GO InterPro


Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110110)
MW 63814.8 Da
SQ 580 aa
 
........10........20........30........40........50
| | | | |
MSMHSPVARVISHSRASHCLRPLLLSALALALAACQSGDKGDPGKPAAAT
AAATPAAGMPDNAQAPAAQTPMPQFVSKDGKHALMVDGAPFLILGAQVNN
SSNYPGIMDKVWPAMQVLGPNTVQVPIAWEQVEPEEGKFDFSFVDTLLDQ
AREHKVRLVLLWFATWKNNGPQYAPHWVKTDNQRFPRVVTREGKSIGSLS
PHAQATLDADRKAFVAFMQHLKKVDPQHTVIMIQPENEAGTYGSVRDFSP
MAQKLFDGQVPDELIKRMNKQPGTWAQVFGADADEIFHAWSIGRYIDQIA
QAGKAEYPLPMYVNAALRGPFNPGQPGQYASGGPTDNVLDVWKVAGPHID
LLAPDIYMPEYRMYTTVLERYARPDNALFVAETGNRPEYARYLYSTLGHN
GIGWSAFGIDYTRYSNYPLGAKHVNEETLAPFALGFQAVSMGMRPFAKAA
SEGKLHGTAEEPGQAVQELKLNDRWSATITYGVPQFWFKGDPPGNPEPIG
AALIAELSPDEFLVTGYHARVTLHPASDATANMIYDRVEEGVYEGNDWKF
QRNWNGDQTDYGVNFSSVPQLLKIKLATYK
XFF4834R

XFF4834R_chr25620 lcl|XFF4834R_chr28120927_2968567_r3_XFF4834R-XFF4834R_chr25620

75

579

S=1058 I=43 E=2.37679e-121

X.species

YP_363535.1 lcl|XCV1804

1

580

S=2803 I=91 E=0

putative secreted protein

X.species

NP_642100.1 lcl|XAC1772-XAC1772

1

580

S=2748 I=90 E=0

hypothetical protein

X.species

NP_637121.1 lcl|XCC1754

75

579

S=2567 I=93 E=0

hypothetical protein

X.species

NP_642855.1 lcl|XAC2540-XAC2540

75

579

S=1054 I=42 E=2.2735e-120

hypothetical protein

X.species

YP_364467.1 lcl|XCV2736

75

579

S=1023 I=42 E=1.2969e-116

putative secreted protein

X.species

NP_637758.1 lcl|XCC2404

75

579

S=987 I=42 E=2.784e-112

hypothetical protein

pubmed

1

579

S=2628 I=85 E=0

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase

Pubmed 17693725

 

prodomImg

PDA1I8I3

299

500

S=484 I=54 E=4.12249e-51

PD853446

501

580

S=273 I=60 E=1.55956e-25

PD856999

217

283

S=185 I=56 E=7.76029e-15

PD416979

159

213

S=164 I=57 E=2.76683e-12

PDA816G2

1

62

S=136 I=48 E=6.54272e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6GYk350X)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAOI6Lp/XFF4834R_chr27400.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAOI6Lp/XFF4834R_chr27400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAOI6Lp/XFF4834R_chr27400.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAOI6Lp/XFF4834R_chr27400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.