Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr27310greBXFF4834R_chr27310transcription elongation factor

greB XFF4834R_chr27310
XFF4834R_chr27300
XFF4834R_chr27300
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27320
XFF4834R_chr27320
ID greB
AC XFF4834R_chr27310
LT XFF4834R_chr27310
OR XFF4834R_chr from 3148594 to 3149100 on strand +
DE transcription elongation factor
IP Transcription elongation factor GreB, prokaryotic
CL 2.2.2 Transcription related GO:0006350
EC
GO InterPro
DNA-dependent (GO:0006355)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: transcription elongation regulator activity (GO:0003711)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120315)
MW 18829 Da
SQ 168 aa
 
........10........20........30........40........50
| | | | |
MSRWRPPAEKSTALITPEGHARLKAELDDLWRVRRPEVVRALAAAAAEGD
RSENAEYTYRKKQLGEIDRRVRYLSKRLEALRVVDTAPTDANAVFFGAQV
ELEDADSGELLRYRIVGPDETDAGRGWISIDSPLARALLKKRVDDEFDAH
LPAGKHTFVVVSVDYASL
Hamap GREA_MF_00105 raw_score=3168 norm_score=24.332

Transcription elongation factor greA [greA].

XFF4834R

XFF4834R_chr20090 lcl|greA-XFF4834R_chr20090

15

165

S=181 I=33 E=8.94073e-16

transcription elongation factor

X.species

NP_643043.1 lcl|greB-XAC2734

1

168

S=712 I=85 E=1.41889e-79

transcription elongation factor GreB

X.species

YP_364617.1 lcl|greB-XCV2886

1

168

S=703 I=84 E=1.50692e-78

transcription elongation factor GreB

X.species

NP_637911.1 lcl|greB-XCC2563

1

167

S=674 I=80 E=5.70608e-75

transcription elongation factor GreB

X.species

lcl|greB-XALc_0974

1

167

S=613 I=72 E=1.16971e-67

probable transcription elongation factor greb (transcript cleavage factor greb) protein

X.species

lcl|greA-XALc_1340

15

165

S=188 I=34 E=4.64283e-16

probable transcription elongation factor grea (transcript cleavage factor grea) protein

X.species

NP_637209.1 lcl|greA-XCC1844

15

165

S=181 I=34 E=3.13348e-15

transcription elongation factor GreA

X.species

YP_363641.1 lcl|greA-XCV1910

15

165

S=181 I=33 E=3.21652e-15

transcription elongation factor GreA

X.species

NP_642189.1 lcl|greA-XAC1863

15

165

S=181 I=33 E=3.21652e-15

transcription elongation factor GreA

pubmed

12

166

S=306 I=45 E=6.2424e-29

Transcription elongation factor greB ; DNA-binding regulation

Pubmed 8431948

 

prodomImg

pubmed

5

168

S=215 I=40 E=6.40484e-18

Transcription elongation factor GreB

Pubmed 17400765

 

prodomImg

pubmed

15

165

S=181 I=34 E=1.04016e-13

Transcription elongation factor greA ; Coiled DNA-binding regulation

Pubmed 10784047

 

prodomImg

pubmed

15

165

S=177 I=32 E=3.12033e-13

Transcription elongation factor greA ; DNA-binding regulation

Pubmed 2243801

 

prodomImg

pubmed

56

166

S=167 I=33 E=5.44722e-12

Transcription elongation factor ; DNA-binding regulation

Pubmed 15287875

 

prodomImg

pubmed

56

166

S=167 I=33 E=5.49492e-12

Transcription elongation factor greA ; DNA-binding regulation

Pubmed 11157937

 

prodomImg

pubmed

15

165

S=164 I=28 E=9.85501e-12

Transcription elongation factor greA ; DNA-binding regulation

Pubmed 18700039

 

prodomImg

pubmed

16

163

S=161 I=26 E=2.85503e-11

Transcription elongation factor greA ; Coiled DNA-binding regulation

Pubmed 17107561

 

prodomImg

pubmed

56

166

S=158 I=33 E=5.2105e-11

Transcription elongation factor greA ; DNA-binding regulation

Pubmed 9756877

 

prodomImg

pubmed

56

165

S=156 I=32 E=1.13208e-10

Transcription elongation factor ; DNA-binding regulation

Pubmed 17618403

 

prodomImg

sp

1

168

S=712 I=85 E=3.28092e-78

Transcription elongation factor greB ; DNA-binding regulation

 

prodomImg

sp

1

167

S=674 I=80 E=1.31943e-73

Transcription elongation factor greB ; DNA-binding regulation

 

prodomImg

Iprscan IPR001437 [G3DSA:1.10.287.180]

10

84

Transcription elongation factor, GreA/GreB region, prokaryotic

Iprscan IPR001437 [G3DSA:3.10.50.30]

84

166

Transcription elongation factor, GreA/GreB region, prokaryotic

Iprscan [MF_00105]

10

165

-

Iprscan IPR001437 [PF03449]

9

83

Transcription elongation factor, GreA/GreB region, prokaryotic

Iprscan IPR001437 [PF01272]

89

165

Transcription elongation factor, GreA/GreB region, prokaryotic

Iprscan IPR006358 [TIGR01461]

11

167

Transcription elongation factor GreB, prokaryotic

Iprscan IPR018151 [PS00829]

26

57

Transcription elongation factor, GreA/GreB, conserved site

Iprscan IPR018151 [PS00830]

129

145

Transcription elongation factor, GreA/GreB, conserved site

Iprscan [seg]

32

55

-

PD004918

98

154

S=161 I=54 E=4.36198e-12

PD882860

59

97

S=122 I=65 E=2.61971e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one lSTTCHZI)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

25 hits
swiss-prot

Swiss-Prot ncbi-blastp

270 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdCFv0G/XFF4834R_chr27310.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdCFv0G/XFF4834R_chr27310.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdCFv0G/XFF4834R_chr27310.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdCFv0G/XFF4834R_chr27310.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.