Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr26190gumEXFF4834R_chr26190xanthan biosynthesis exopolysaccharide polymerase

gumE XFF4834R_chr26190
XFF4834R_chr26180
XFF4834R_chr26180
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr26200
XFF4834R_chr26200
ID gumE
AC XFF4834R_chr26190
LT XFF4834R_chr26190
OR XFF4834R_chr from 3024707 to 3026008 on strand -
DE xanthan biosynthesis exopolysaccharide polymerase
IP
CL 1.6 Macromolecules (cellular constituent) biosynthesis GO:0009059
EC
GO InterPro


Curated
PM
AN
CC COG: []
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20101025)
MW 48166.6 Da
SQ 433 aa
 
........10........20........30........40........50
| | | | |
MLIRMSAETRVRWHNLLIELTLLVGVGYNLVLAFINANVFTVRPVITYAV
EFMVYAACFLLGMGSLSRKRIALIVSGLGLIVTLMFVRFLVNWQIDPKFF
RDALVVFAFVVLGSAYTGSVPKLFIRMTIIVSLVAAFELAMPVKYGDLIN
PKSFFVNARGMSAEGFWNEDSNLFVSATRPGERNFLPGSNLPRASSMFIE
PVTMGNYICFFTAIVLVFWRWMRPAALILSVGLIGFMIVASDGRLAAGTC
VLMVLLTPLLKRLDQRLAFLVFLLVIMSAWLLVWVTGITAYQDTTMGRVF
FTVYSMNNLSFESWMGLDFAQAYRYFDSGISYFIASQSIVGVLAFLLAYS
FLLLMPSKEGQLFKNLAIFAFALSLLVSNGYFSIKTSALWWFVCGCMWHM
LPTWSASGTQTASIKDDPTADGAQLPSPAGAAR
X.species

YP_364515.1 lcl|gumE-XCV2784

1

433

S=2158 I=96 E=0

xanthan biosynthesis exopolysaccharide polymerase GumE

X.species

NP_642896.1 lcl|gumE-XAC2582

1

433

S=2151 I=96 E=0

GumE protein

X.species

NP_637804.1 lcl|gumE-XCC2451

1

433

S=1925 I=85 E=0

gumE protein

pubmed

1

433

S=1926 I=85 E=0

GumE

Pubmed 7565082

 

prodomImg

pubmed

1

305

S=1428 I=90 E=3.50486e-164

GumD gene

Pubmed 9144435

 

prodomImg

pubmed

23

402

S=219 I=26 E=1.07942e-17

4B3

Pubmed 17014983

 

prodomImg

Iprscan [seg]

343

354

-

Iprscan [tmhmm]

13

35

-

Iprscan [tmhmm]

45

64

-

Iprscan [tmhmm]

71

93

-

Iprscan [tmhmm]

103

125

-

Iprscan [tmhmm]

197

219

-

Iprscan [tmhmm]

234

256

-

Iprscan [tmhmm]

269

291

-

Iprscan [tmhmm]

333

355

-

Iprscan [tmhmm]

362

384

-

PD140815

1

403

S=1922 I=92 E=0

PD678584

403

433

S=154 I=94 E=3.89782e-11

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9YPAhd1S)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqLNfyv/XFF4834R_chr26190.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqLNfyv/XFF4834R_chr26190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqLNfyv/XFF4834R_chr26190.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqLNfyv/XFF4834R_chr26190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.