Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr26180gumFXFF4834R_chr26180xanthan biosynthesis acetyltransferase

gumF XFF4834R_chr26180
XFF4834R_chr26170
XFF4834R_chr26170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr26190
XFF4834R_chr26190
ID gumF
AC XFF4834R_chr26180
LT XFF4834R_chr26180
OR XFF4834R_chr from 3023619 to 3024710 on strand -
DE xanthan biosynthesis acetyltransferase
IP Acyltransferase 3
CL 1.6 Macromolecules (cellular constituent) biosynthesis GO:0009059
EC
GO InterPro
transferring acyl groups other than amino-acyl groups (GO:0016747)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 39642.9 Da
SQ 363 aa
 
........10........20........30........40........50
| | | | |
MSVSAMPASPSALPAADAQLTTSGRVRDPRIDATKAIAILLVVFCHAKGV
PHGMTLFAYSFHVPLFFLVSGWLAAGYASRNTGLTQTISKQARSLLLPYV
TFYLLGYVYWLLTRNIGEKAARWGSHPWWEPIVAMFTGVGPDLYVQPPLW
FLPVMLVTVVSYMVLRRLMSPILIAGLALIVAWFWMNWFPAQHVRIFFGL
DVLPVSLCFYALGALLIYLSPRLPTSLAGSALATVVLALAVAWLAQANGR
IDVNMLEFGHNYALFLVSALLGSLMVICAARLVQSWAWLQWIGRNTLLIL
CTHMLVFFVLSGVAALAGGLGGARPGLGWAIFVTLFALAASVPLRWILMR
FAPWALGARPVAA
XFF4834R

XFF4834R_chr26170 lcl|XFF4834R_chr_3022517_3023605_r3_XFF4834R-XFF4834R_chr26170

26

359

S=584 I=41 E=3.65064e-64

X.species

NP_642895.1 lcl|gumF-XAC2581

19

363

S=1487 I=85 E=4.61281e-173

GumF protein

X.species

YP_364514.1 lcl|gumF-XCV2783

19

358

S=1396 I=81 E=5.07474e-162

xanthan biosynthesis acetyltransferase GumF

X.species

NP_637803.1 lcl|gumF-XCC2450

23

363

S=1291 I=76 E=2.63329e-149

GumF protein

X.species

NP_637802.1 lcl|gumG-XCC2449

27

359

S=638 I=42 E=3.98203e-70

GumG protein

X.species

YP_364513.1 lcl|gumG-XCV2782

21

357

S=615 I=41 E=2.35411e-67

xanthan biosynthesis acetyltransferase GumG

X.species

NP_642894.1 lcl|gumG-XAC2580

21

359

S=602 I=40 E=7.37047e-66

GumG protein

pubmed

23

363

S=1297 I=76 E=2.32667e-148

GumF ; Membrane

Pubmed 7565082

 

prodomImg

pubmed

27

352

S=626 I=42 E=4.4062e-67

GumG ; Membrane

Pubmed 7565082

 

prodomImg

Iprscan IPR002656 [PF01757]

29

344

Acyltransferase 3

Iprscan [seg]

4

18

-

Iprscan [seg]

227

247

-

Iprscan [seg]

310

328

-

Iprscan [tmhmm]

53

75

-

Iprscan [tmhmm]

95

117

-

Iprscan [tmhmm]

143

165

-

Iprscan [tmhmm]

172

191

-

Iprscan [tmhmm]

196

218

-

Iprscan [tmhmm]

225

247

-

Iprscan [tmhmm]

262

284

-

Iprscan [tmhmm]

297

316

-

Iprscan [tmhmm]

326

348

-

PD904049

110

223

S=457 I=75 E=7.68198e-48

PD862277

250

362

S=312 I=52 E=2.80081e-30

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one b1yPn52Q)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsvlMpn/XFF4834R_chr26180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsvlMpn/XFF4834R_chr26180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsvlMpn/XFF4834R_chr26180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsvlMpn/XFF4834R_chr26180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.