Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr26170gumGXFF4834R_chr26170xanthan biosynthesis acetyltransferase

gumG XFF4834R_chr26170
XFF4834R_chr26160
XFF4834R_chr26160
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr26180
XFF4834R_chr26180
ID gumG
AC XFF4834R_chr26170
LT XFF4834R_chr26170
OR XFF4834R_chr from 3022517 to 3023605 on strand -
DE xanthan biosynthesis acetyltransferase
IP Acyltransferase 3
CL 1.6 Macromolecules (cellular constituent) biosynthesis GO:0009059
EC
GO InterPro
transferring acyl groups other than amino-acyl groups (GO:0016747)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 39664.6 Da
SQ 362 aa
 
........10........20........30........40........50
| | | | |
MTSGFSSPHDMRAHHLADASKAPALTRDWQIDAAKALAIALVVLGHASGM
PPAYKLFAYSFHVPLFFVLSGWVGERFGHRALTAASVAKLARTLLVPYLA
FFMVAYALWLLTAAIDGHAGHPQTRLWWHPLTGLLWANGSRLYVLPALWF
LPALFVTTLAYIALRARLSAAAVAAISLPLALAWAGWFPSLQQRVPLALD
VLPVALFFIAFGGWLSRFADALRSLRAQVWALALLPLAALWWWLARWNGQ
VDVNNLQFGQSAAVFLLVSLLGTAMTFCLAHFIRRLRWVQWIGTNTLLIL
CTHTLVFLVTTSVVARTGLIARSAIGTPAWALGLSAFAFAASVPMRAVLV
PMAPWMLGLKRK
XFF4834R

XFF4834R_chr26180 lcl|XFF4834R_chr28660619_3024710_r2_XFF4834R-XFF4834R_chr26180

8

360

S=445 I=33 E=2.08905e-47

X.species

NP_642894.1 lcl|gumG-XAC2580

1

362

S=1334 I=75 E=1.67451e-154

GumG protein

X.species

YP_364513.1 lcl|gumG-XCV2782

1

362

S=1266 I=73 E=2.7822e-146

xanthan biosynthesis acetyltransferase GumG

X.species

NP_637802.1 lcl|gumG-XCC2449

18

362

S=846 I=54 E=2.29891e-95

GumG protein

X.species

YP_364514.1 lcl|gumF-XCV2783

8

361

S=438 I=34 E=6.61988e-46

xanthan biosynthesis acetyltransferase GumF

X.species

NP_642895.1 lcl|gumF-XAC2581

26

360

S=433 I=34 E=2.26333e-45

GumF protein

X.species

NP_637803.1 lcl|gumF-XCC2450

26

360

S=416 I=33 E=2.85929e-43

GumF protein

pubmed

18

353

S=805 I=53 E=9.71404e-89

GumG ; Membrane

Pubmed 7565082

 

prodomImg

pubmed

26

360

S=419 I=33 E=5.02936e-42

GumF ; Membrane

Pubmed 7565082

 

prodomImg

pubmed

295

350

S=180 I=73 E=4.82416e-13

GumG homolog

Pubmed 10481086

 

prodomImg

Iprscan IPR002656 [PF01757]

30

343

Acyltransferase 3

Iprscan [seg]

33

44

-

Iprscan [seg]

159

183

-

Iprscan [seg]

195

206

-

Iprscan [seg]

230

247

-

Iprscan [seg]

329

342

-

Iprscan [tmhmm]

56

73

-

Iprscan [tmhmm]

93

115

-

Iprscan [tmhmm]

142

164

-

Iprscan [tmhmm]

171

188

-

Iprscan [tmhmm]

198

216

-

Iprscan [tmhmm]

229

246

-

Iprscan [tmhmm]

261

283

-

Iprscan [tmhmm]

296

318

-

Iprscan [tmhmm]

328

350

-

PD862277

250

361

S=234 I=45 E=6.74062e-21

PD904049

109

229

S=180 I=36 E=2.35386e-14

PDA4C1P0

1

26

S=110 I=85 E=8.13485e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one uKZOR5Vc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6NGOw7/XFF4834R_chr26170.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6NGOw7/XFF4834R_chr26170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6NGOw7/XFF4834R_chr26170.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6NGOw7/XFF4834R_chr26170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.