Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr26140gumJXFF4834R_chr26140probable xanthan biosynthesis oligosaccharidyl-lipid flippase GumJ

gumJ XFF4834R_chr26140
XFF4834R_chr26130
XFF4834R_chr26130
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr26150
XFF4834R_chr26150
ID gumJ
AC XFF4834R_chr26140
LT XFF4834R_chr26140
OR XFF4834R_chr from 3018753 to 3020264 on strand -
DE probable xanthan biosynthesis oligosaccharidyl-lipid flippase GumJ
IP Polysaccharide biosynthesis protein
CL 1.6 Macromolecules (cellular constituent) biosynthesis GO:0009059
EC
GO InterPro
Biological Process: polysaccharide biosynthetic process (GO:0000271)
Cellular Component: membrane (GO:0016020)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100929)
MW 53910.2 Da
SQ 503 aa
 
........10........20........30........40........50
| | | | |
MTAETPTMTSSTPPPPPQRSLGSRAAGGAAVTMLGQSAKMVVQFGGIILL
ARLLTPYDYGLMAMVTAIVGAAEILRDFGLSAAAVQAKQVSREQRDNLFW
INSGIGLALSLVVFASAHLIANFYKEPALVTISQALAVTFLINGMTTQYR
AHLSRGLRFGQVALSDVGSQVLGLGAAVAAALLGWGYWALVVQQVVQAGV
NFIIAASCARWLPGGYQRSAPMRDFMSFGWNLMAAQLLGYASRNVGQVII
GWRTGPDALGLYNRAFQLLMMPLNQINAPATSVALPVLSQLQDDRERFSA
FLLRGQTVMVHLIFALFAFACALAMPLIVLVLGEQWREAVPLFQVLTLGG
IFQTAAYATYWVFLARGLMRAQLVYSLVSRVLLIACIFVGSRWGAMGVAI
GYSFGLLVTWPLSLLWIGKISDVPVGALFTNALRAMVAYGVAGGCAYYAS
ITVGGPLWEQLAVGAVTMLAVCLLALAIWPAFRRDVVAIVNIRKLLTQAK
APR
X.species

NP_642891.1 lcl|gumJ-XAC2577

1

503

S=2046 I=84 E=0

GumJ protein

X.species

YP_364510.1 lcl|gumJ-XCV2779

1

503

S=2037 I=84 E=0

xanthan biosynthesis oligosaccharidyl-lipid flippase GumJ

X.species

NP_637799.1 lcl|gumJ-XCC2446

19

503

S=1908 I=79 E=0

GumJ protein

pubmed

19

503

S=1901 I=79 E=0

GumJ

Pubmed 7565082

 

prodomImg

pubmed

18

420

S=1687 I=84 E=0

GumJ

Pubmed 10940020

 

prodomImg

pubmed

41

384

S=324 I=27 E=2.2106e-30

Teichuronic acid biosynthesis protein tuaB ; Cell membrane wall biogenesis/degradation Stress response Transmembrane

Pubmed 10048024

 

prodomImg

pubmed

41

384

S=314 I=26 E=3.24156e-29

Putative uncharacterized protein tuaB

Pubmed 17928718

 

prodomImg

pubmed

49

402

S=300 I=22 E=2.05651e-27

Lipopolysaccharide biosynthesis protein wzxC ; Cell inner membrane Transmembrane

Pubmed 8759852

 

prodomImg

pubmed

40

402

S=289 I=23 E=3.78289e-26

Uncharacterized membrane protein in cps region ; Cell Exopolysaccharide synthesis Transmembrane

Pubmed 7896702

 

prodomImg

pubmed

49

402

S=289 I=22 E=3.88314e-26

Putative export protein Flippase

Pubmed 11004393

 

prodomImg

pubmed

34

402

S=254 I=22 E=6.58732e-22

Wzx

Pubmed 15109730

 

prodomImg

pubmed

34

367

S=242 I=22 E=2.15432e-20

O-antigen flippase

Pubmed 11598067

 

prodomImg

pubmed

34

367

S=240 I=22 E=3.79694e-20

Wzx

Pubmed 15774901

 

prodomImg

sp

41

384

S=324 I=27 E=1.52208e-30

Teichuronic acid biosynthesis protein tuaB ; Cell membrane wall biogenesis/degradation Stress response Transmembrane

 

prodomImg

sp

49

402

S=300 I=22 E=1.41598e-27

Lipopolysaccharide biosynthesis protein wzxC ; Cell inner membrane Transmembrane

 

prodomImg

sp

40

402

S=289 I=23 E=2.60465e-26

Uncharacterized membrane protein in cps region ; Cell Exopolysaccharide synthesis Transmembrane

 

prodomImg

sp

80

384

S=134 I=20 E=1.50619e-07

Amylovoran biosynthesis protein amsL ; Cell membrane Exopolysaccharide Transmembrane Virulence

 

prodomImg

Iprscan IPR002797 [PF01943]

25

292

Polysaccharide biosynthesis protein

Iprscan [seg]

5

17

-

Iprscan [seg]

25

30

-

Iprscan [seg]

171

197

-

Iprscan [seg]

312

324

-

Iprscan [seg]

435

449

-

Iprscan [tmhmm]

98

120

-

Iprscan [tmhmm]

170

192

-

Iprscan [tmhmm]

310

332

-

Iprscan [tmhmm]

342

364

-

Iprscan [tmhmm]

377

396

-

Iprscan [tmhmm]

406

428

-

Iprscan [tmhmm]

435

457

-

Iprscan [tmhmm]

461

483

-

PD583584

333

419

S=163 I=38 E=3.50917e-12

PD369536

92

170

S=156 I=44 E=2.60676e-11

PD130862

422

503

S=147 I=43 E=3.35387e-10

PD583708

32

92

S=132 I=46 E=1.83465e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one XLITR07u)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

19 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwfYIoS/XFF4834R_chr26140.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwfYIoS/XFF4834R_chr26140.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwfYIoS/XFF4834R_chr26140.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwfYIoS/XFF4834R_chr26140.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.