Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr26120gumLXFF4834R_chr26120 gumL protein

gumL XFF4834R_chr26120
XFF4834R_chr26110
XFF4834R_chr26110
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr26130
XFF4834R_chr26130
ID gumL
AC XFF4834R_chr26120
LT XFF4834R_chr26120
OR XFF4834R_chr from 3016661 to 3017455 on strand -
DE gumL protein
IP ExoV-like protein
CL 1.6 Macromolecules (cellular constituent) biosynthesis GO:0009059
EC
GO InterPro


Curated
PM
AN GumL is 23.7% identical to ketal pyruvate transferase ExoV of R. meliloti (20), which is involved in the addition of a pyruvate substituent to the terminal glucose of the side chain of succinoglycan (44). Although, insertions in exoV seem to be deleterious, gumL mutants are not affected in growth and produce normal nonpyruvylated polymer levels (data not shown). gumL mutants are able to produce a labeled polysaccharide. Whereas gumF, gumG, and gumL strains produced amounts of polymer similar to those produced by the wild type
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20101122)
MW 29419.5 Da
SQ 264 aa
 
........10........20........30........40........50
| | | | |
MANALLQKWIEHAERRALFWWQPKNAGVNMGDHLSKVIVSCVLSLQDKTL
IEKRDLSKKLIAIGSVLHFAKDGDTVWGSGINGKIPAERNTFRTLDVRAV
RGPKTRKFLLDRGIAVPEVYGDPGLLTPMFFPADALGAINKRPFAIVPHF
NEPVEKYSAYKDHLVFPNVKPATFMSALLGAELVISSSLHGLILAEAYGI
PAVYLDWGNGEDRFKYDDYYNGTGRMQWHSGNSVEECLQLGGNGDFDLER
LQAGLLAAFPYDLW
Show or not Domain decomposition
 
XFF4834R

NP_642889.1 lcl|gumL-XAC2575

1

264

S=1391 I=99 E=1.52434e-161

GumL protein

XFF4834R

YP_364508.1 lcl|gumL-XCV2777

1

264

S=1390 I=99 E=1.62027e-161

xanthan biosynthesis pyruvyltransferase GumL

XFF4834R

NP_637797.1 lcl|gumL-XCC2444

1

264

S=1298 I=91 E=2.37679e-150

GumL protein

pubmed

1

264

S=1316 I=93 E=5.41317e-151

GumL

Pubmed 10940020

 

prodomImg

pubmed

1

264

S=1307 I=91 E=6.72592e-150

GumL

Pubmed 7565082

 

prodomImg

pubmed

60

260

S=240 I=35 E=1.33518e-20

WbuT

Pubmed 16088333

 

prodomImg

pubmed

60

260

S=240 I=35 E=1.33518e-20

Putative uncharacterized protein WbuT

Pubmed 17449692

 

prodomImg

pubmed

60

224

S=115 I=28 E=1.88515e-05

Succinoglycan biosynthesis protein exoV ; Exopolysaccharide Plasmid

Pubmed 8226645,8226646

 

prodomImg

sp_Pdown

sp|P33701|EXOV_RHIME

60

224

S=115 I=28 E=1.30018e-05

Succinoglycan biosynthesis protein exoV ; Exopolysaccharide Plasmid

Iprscan IPR014970 [PF08871]

27

231

ExoV-like protein

PD137965

14

261

S=488 I=45 E=1.37688e-51

PD123312

230

264

S=165 I=86 E=1.74636e-12

PDA9A3W7

1

23

S=120 I=96 E=5.03817e-07

PDA3F3V9

241

264

S=115 I=88 E=1.75284e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one OsK8ROBw)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsnFvEy/XFF4834R_chr26120.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsnFvEy/XFF4834R_chr26120.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsnFvEy/XFF4834R_chr26120.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsnFvEy/XFF4834R_chr26120.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.