Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr25860TXfu2XFF4834R_chr25860Xfu2 transposase

TXfu2 XFF4834R_chr25860
XFF4834R_chr25840
XFF4834R_chr25840
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25870
XFF4834R_chr25870
ID TXfu2
AC XFF4834R_chr25860
LT XFF4834R_chr25860
OR XFF4834R_chr from 2994471 to 2995451 on strand -
DE Xfu2 transposase
IP Transposase, IS4-like
CL 8.3.1 transposases GO:0004803
EC
GO InterPro
DNA-mediated (GO:0006313)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: transposase activity (GO:0004803)

Curated
PM
AN ISXfu2 shares 92% nucleotidic identity with ISXo1 that belongs to IS5 family and IS5 group. There are 33 insertions of ISXfu2 in CFBP4834-R genome. Twenty-six copies contain a 326 aa transposase gene and 25 of them have complete IR. One of the complete copies is plasmidic. Four copies of ISXfu2 have a frameshift or a stop in the transposase gene. Three copies of ISXfu2 are fragments, truncated on the left side and without a complete transposase gene.
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120926)
MW 36528.7 Da
SQ 326 aa
 
........10........20........30........40........50
| | | | |
MQLTFGDAEGLGKRKQTRREIFLAEMEQVVPWQQLLGLIALHYPTSGRPG
RQPYALATMLRIHLLQQWYALSDPAMEEALHEIPTLRRFAQLGGLDNVPD
ETTILNFRRLLETHGIAARMLEAVNAHLSRKGQSLRSGTIVDATLIAAPS
STKNADRARDPEMHQTKKGNQWYFGMKAHIGVDEFSGLVHHVQCTAANVA
DVTVTHALLHGKEGSVFGDSGYTGAEKRDELQRCEAAFFIAAKRSTIQAI
GNKRERAGAERWEHFKASVRAKVEHPFRVIKHQFGYTKVRYRGLAKNTAQ
VLTLFALSNLWMKRKQLLSAAGSVRL
XFF4834R

XFF4834R_pla00290 lcl|XFF4834R_pla00220242_0022222_r2_XFF4834R-XFF4834R_pla00290

1

326

S=1742 I=100 E=0

XFF4834R

XFF4834R_chr42720 lcl|XFF4834R_chr_4950273_4951253_f3_XFF4834R-XFF4834R_chr42720

1

326

S=1742 I=100 E=0

XFF4834R

XFF4834R_chr42030 lcl|XFF4834R_chr_4882336_4883316_f1_XFF4834R-XFF4834R_chr42030

1

326

S=1742 I=100 E=0

XFF4834R

XFF4834R_chr41990 lcl|XFF4834R_chr_4879033_4880013_r1_XFF4834R-XFF4834R_chr41990

1

326

S=1742 I=100 E=0

XFF4834R

XFF4834R_chr34030 lcl|XFF4834R_chr36930613_3931593_r1_XFF4834R-XFF4834R_chr34030

1

326

S=1742 I=100 E=0

XFF4834R

XFF4834R_chr32060 lcl|XFF4834R_chr34630390_3681370_r3_XFF4834R-XFF4834R_chr32060

1

326

S=1742 I=100 E=0

XFF4834R

XFF4834R_chr31870 lcl|XFF4834R_chr34430304_3658284_f1_XFF4834R-XFF4834R_chr31870

1

326

S=1742 I=100 E=0

XFF4834R

XFF4834R_chr25940 lcl|XFF4834R_chr_2999698_3000678_f1_XFF4834R-XFF4834R_chr25940

1

326

S=1742 I=100 E=0

XFF4834R

XFF4834R_chr25590 lcl|XFF4834R_chr28100643_2965623_f1_XFF4834R-XFF4834R_chr25590

1

326

S=1742 I=100 E=0

XFF4834R

XFF4834R_chr25420 lcl|XFF4834R_chr27840104_2937084_r1_XFF4834R-XFF4834R_chr25420

1

326

S=1742 I=100 E=0

X.species

NP_638931.1 lcl|XCC3585

1

326

S=1644 I=94 E=0

IS1479 transposase

X.species

NP_638649.1 lcl|XCC3303

1

326

S=1644 I=94 E=0

IS1479 transposase

X.species

NP_636979.1 lcl|XCC1609

1

326

S=1644 I=94 E=0

IS1479 transposase

X.species

NP_635522.1 lcl|XCC0127

1

326

S=1644 I=94 E=0

IS1479 transposase

X.species

NP_638057.1 lcl|XCC2709

1

326

S=1632 I=94 E=0

IS1479 transposase

X.species

NP_636622.1 lcl|XCC1248

1

326

S=1632 I=93 E=0

IS1479 transposase

X.species

NP_637822.1 lcl|XCC2470

1

326

S=1631 I=94 E=0

IS1479 transposase

X.species

YP_365907.1 lcl|XCV4176

1

326

S=1631 I=93 E=0

IS1479 transposase

X.species

YP_365126.1 lcl|XCV3395

1

326

S=1631 I=93 E=0

IS1479 transposase

X.species

YP_363025.1 lcl|XCV1294

1

326

S=1631 I=93 E=0

IS1479 transposase

pubmed

1

322

S=1615 I=94 E=0

Putative transposase

Pubmed 10940020

 

prodomImg

pubmed

2

325

S=1059 I=65 E=1.24757e-119

IS2000 transposase Transposase

Pubmed 10427724,10049269

 

prodomImg

pubmed

2

326

S=1053 I=64 E=6.42583e-119

Transposase ; Plasmid

Pubmed 12547188,15466034

 

prodomImg

pubmed

2

326

S=1051 I=64 E=9.43052e-119

DDE-type transposase

Pubmed 18487340

 

prodomImg

pubmed

2

326

S=1051 I=65 E=1.05623e-118

Transposase ; Plasmid

Pubmed 11371531,9244273

 

prodomImg

pubmed

2

326

S=1051 I=65 E=1.05623e-118

Transposase ; Plasmid

Pubmed 12177326,15288784

 

prodomImg

pubmed

2

326

S=1047 I=64 E=3.67477e-118

Transposase-like protein TnpA3

Pubmed 9765796,11133479

 

prodomImg

pubmed

2

326

S=1046 I=64 E=4.37482e-118

Transposase like protein TnpA1

Pubmed 10433976

 

prodomImg

pubmed

2

326

S=1045 I=64 E=5.78267e-118

DDE-type transposase

Pubmed 15941993

 

prodomImg

pubmed

2

326

S=1045 I=64 E=5.9879e-118

Transposase

Pubmed 11371531,9244273

 

prodomImg

Iprscan IPR002559 [PF01609]

135

312

Transposase, IS4-like

PD186263

99

154

S=213 I=75 E=2.87999e-18

PD007264

59

95

S=164 I=86 E=2.22539e-12

PDA839M8

21

87

S=163 I=45 E=3.12666e-12

PD897745

216

250

S=155 I=83 E=2.74107e-11

PD621928

259

288

S=146 I=90 E=3.12144e-10

PD688766

289

322

S=142 I=82 E=9.69617e-10

PDA872X8

153

224

S=135 I=42 E=8.50042e-09

PDA1F8G8

155

180

S=134 I=92 E=1.06632e-08

PDA2X8R0

1

51

S=133 I=54 E=1.24752e-08

PDA1G7E8

1

25

S=127 I=100 E=7.25973e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jRPQxonO)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

74 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

58 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzucazD/XFF4834R_chr25860.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzucazD/XFF4834R_chr25860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzucazD/XFF4834R_chr25860.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzucazD/XFF4834R_chr25860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.