Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr25620XFF4834R_chr25620XFF4834R_chr25620putative beta-galactosidase

XFF4834R_chr25620 XFF4834R_chr25620
XFF4834R_chr25610
XFF4834R_chr25610
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25630
XFF4834R_chr25630
ID XFF4834R_chr25620
AC XFF4834R_chr25620
LT XFF4834R_chr25620
OR XFF4834R_chr from 2966927 to 2968564 on strand -
DE putative beta-galactosidase
IP
CL 1.2.4 Polysaccharides GO:0000272
EC
GO InterPro


Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110112)
MW 59725.1 Da
SQ 545 aa
 
........10........20........30........40........50
| | | | |
MRLFARFKAQPRGRVAGLLWSLALLAGSTPPLAAAEELPRFVTKDGRHAV
LVDGAPYTILAAQLHNSSAWPAVLPQALDDVVALHANTVEAPVYWEQFEP
EQGRFDTTNVDALIAGARKRGLRVALLWFGSWKNGQMHYVPEWIKRDEAT
YPRMRDANGEPVDVLSPHVAANMQADARAFTALMQHLRKVDGDRHTVILV
QVENEPGAIGTVRDHGPAGEAAFAQPVPAAIARALGKPQGSWQQLFGPEA
AEAFNAYATAAYIEQVAAAGKRAYPLPFYVNTWLRYKGKRYPGMDYPSGG
ATVNVFALWRAATPSIDFIGTDIYTSDYNEYTKVIGQYARPDNPAWVSET
GFEAATAPYLFHVLGQGGVGFSVFGMDGNQDSQANRDAIAAHAANFKLLA
PMQRILAQAAFDGRLQGVAEQPGTPQRTLRFGEWEAKVSFGAPMWGDAPP
ILPGNDDHAGRLLVAQLGPEEFLVTGMAARIEFFRDPADTRRGQLLRVEQ
GRYVDGRWQMERQLNGDQTDYGLNFGRVDANGKVPVVLRVRVGTY
XFF4834R

XFF4834R_chr27400 lcl|XFF4834R_chr29970687_3165429_r1_XFF4834R-XFF4834R_chr27400

33

545

S=987 I=41 E=7.91844e-113

XFF4834R

XFF4834R_chr15460 lcl|XFF4834R_chr16620676_1782517_r3_XFF4834R-XFF4834R_chr15460

33

208

S=121 I=32 E=6.14632e-08

X.species

NP_642855.1 lcl|XAC2540-XAC2540

1

545

S=2465 I=87 E=0

hypothetical protein

X.species

YP_364467.1 lcl|XCV2736

1

545

S=2393 I=85 E=0

putative secreted protein

X.species

NP_637758.1 lcl|XCC2404

30

545

S=2263 I=84 E=0

hypothetical protein

X.species

NP_637121.1 lcl|XCC1754

38

545

S=1028 I=43 E=3.45676e-117

hypothetical protein

X.species

YP_363535.1 lcl|XCV1804

33

545

S=992 I=41 E=8.31105e-113

putative secreted protein

X.species

NP_642100.1 lcl|XAC1772-XAC1772

40

545

S=980 I=41 E=1.86826e-111

hypothetical protein

X.species

NP_643393.1 lcl|bga-XAC3084

33

208

S=120 I=31 E=3.23694e-07

beta-galactosidase

X.species

YP_364945.1 lcl|bga1-XCV3214

53

208

S=115 I=31 E=1.40045e-06

beta-galactosidase

X.species

NP_638243.1 lcl|bga-XCC2895

29

208

S=114 I=29 E=1.66724e-06

beta-galactosidase

pubmed

38

545

S=1027 I=43 E=1.67519e-115

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase

Pubmed 17693725

 

prodomImg

pubmed

29

208

S=126 I=30 E=3.01911e-06

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase

Pubmed 15153767

 

prodomImg

pubmed

36

208

S=122 I=32 E=7.54158e-06

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase Signal

Pubmed 8563148

 

prodomImg

sp

42

210

S=132 I=25 E=3.7117e-07

Beta-galactosidase 16 EC=3.2.1.23 ; Apoplast Glycoprotein Glycosidase Hydrolase Secreted Signal

 

prodomImg

sp

36

208

S=122 I=32 E=5.16533e-06

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase Signal

 

prodomImg

PDA1I8I3

266

461

S=584 I=58 E=3.426e-63

PD853446

463

545

S=271 I=66 E=2.91211e-25

PD416979

125

179

S=230 I=74 E=2.21316e-20

PD856999

183

249

S=137 I=43 E=5.06439e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one llcP2YsR)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfsY5j9/XFF4834R_chr25620.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfsY5j9/XFF4834R_chr25620.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfsY5j9/XFF4834R_chr25620.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfsY5j9/XFF4834R_chr25620.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.