Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr25400XFF4834R_chr27800352_2936014_f2_XFF4834R-XFF4834R_chr25400XFF4834R_chr25400putative rhs family protein

XFF4834R_chr27800352_2936014_f2_XFF4834R-XFF4834R_chr25400 XFF4834R_chr25400
XFF4834R_chr25390
XFF4834R_chr25390
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25420
XFF4834R_chr25420
ID XFF4834R_chr27800352_2936014_f2_XFF4834R-XFF4834R_chr25400
AC XFF4834R_chr25400
LT XFF4834R_chr25400
OR XFF4834R_chr from 2932352 to 2936014 on strand +
DE putative rhs family protein
IP YD repeat;
CL 5 Cell processes GO:0009987
EC
GO InterPro


Curated
PM
AN Rhs elements have a non essential function. They may play an important role in the natural ecology of the cell. These sequences contain two tandem copies of a 21-residue extracellular repeat that is found in Gram-negative, Gram-positive, and animal proteins. The repeat is named for a YD dipeptide, the most strongly conserved motif of the repeat. These repeats appear in general to be involved in binding carbohydrate
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100826)
MW 132457.3 Da
SQ 1220 aa
 
........10........20........30........40........50
| | | | |
MGNPINVATGNKFQQAVDIDDRSGLGFVRYYNSSAIGSDTAIGIGWTHSY
ASRIVFPSDSSSGKIVYAQRADGRSITFFWQPNGTWLPDGGQTSALVEAR
DANGTIVEWHFKERKDGATEAYDLAGRLLRIEPLDGLTTNLTYATASTRL
PSLVTSWQGRAIQLHYDTSGRVSEVIGPDGGIHVYAYDSANHLTAVAHPG
GDTVSYLYGESTQTSGASLANVLTGIVDETAKRYATYRYDTERRAITSMH
GDNHDRYDVTYMDSVNVKVVEPSGALNYRSFTTYNDIRTATNSARSCPGC
TTSSEAWSYDENGHLNEYRDGAGNITDHDQDACGRDMVLTEAKGSPGQRT
TTYVRDQTLGRILESTTRDLSGNSVRHGTSTYNPRGQRTASRTIDPNDST
ERLSVSSYCEQADLDAGRCPQRGLLLSVVTGAPNASRRVDYTYYATDAAA
CATAPTTCAYRKGDRWKVTNALGQTIEYLAYDGAGRPLSIKDANGIVTDY
TYHPRGWLTATKVRGADASSEADDRITRIDYWPTGLVKQVTQPDGAFTAF
TYDAAHWLTDITDNAGNTVHYTLDNAGNRIKEDTTDASGTLKRTLSRVYN
QLGQLKTQATAASEPTDFAYDANGNATTVTDALATATQSEYDPLNRLSRT
LQDVAGIKADTKFAYDALDNLTKVTDPKGLDTTYEYNGFGDLVKLTSPDT
GVTSYTYDSAGNRATQTDARGNTTAYSYDALNRLTKLTYPTTSLNVTYTY
DVTQTACTSGETFSIGRLTKMQDGGAITQYCYNRFGDLVRKVQTSNGKAL
VLRYDYTVGSQLRRMTYPDGAVVDYVRNTQGKTTEVGVTPAGSSRQVLLG
NASYYPFGPAAGWTYGNGRTLARRYDLDYRPQAIQDTRLGGLDVGFGFDP
AGNLTALTPAGNPTPEIGLGYDALGRLTGLKDGRTGTLIDGYSFDATGNR
LSAKVGTATQIYSYPTNSHRLSAVAGVARTYDANGNTTAIGGTARQYTYD
TTGRMNQARRAGAVTMNYRYNGRGEQVRRFLGTTNIYTLYDEAGHWLGDY
DSNGAPKQQAIWLDDLPVGLLANANKLHYIEPDHLGSPRVVIDSTRDVAV
WTWSLKGEAFGNTAPNQDPDGDGAALVLDMRFPGQRFDATSGLNQNGNRE
YEASTGRYSKSDPIGLRGGIGTYRYAFNNPLMWIDPDGLQATMISQGPGM
TGPVGVYNPYGPKDGLINES
XFF4834R

XFF4834R_chr_1497 XFF4834R_chr14760461_1593184_r3_XFF4834R-XFF4834R_chr_1497

461

1199

S=3544 I=92 E=0

XFF4834R

XFF4834R_chr_1497 XFF4834R_chr14760461_1593184_r3_XFF4834R-XFF4834R_chr_1497

121

206

S=104 I=34 E=1.71508e-05

XFF4834R

XFF4834R_chr_1499 XFF4834R_chr14800528_1595559_r1_XFF4834R-XFF4834R_chr_1499

2

196

S=245 I=39 E=1.6224e-22

X.species

NP_643553.1 XAC3245-XAC3245

2

1196

S=3815 I=67 E=0

RhsD protein

X.species

YP_365089.1 XCV3358

201

1189

S=3600 I=73 E=0

Rhs family protein

X.species

YP_365089.1 XCV3358

121

206

S=103 I=34 E=9.79017e-05

Rhs family protein

X.species

YP_364446.1 XCV2715

116

1191

S=3592 I=69 E=0

Rhs family protein

X.species

NP_642844.1 rhsD-XAC2529

3

1189

S=3333 I=59 E=0

RhsD protein

X.species

NP_635524.1 rhsD-XCC0129

1

1209

S=2932 I=53 E=0

RhsD protein

X.species

YP_365898.1 XCV4167

1

1189

S=2884 I=53 E=0

Rhs family protein

X.species

XALc_2378 XALc_2378

2

1211

S=2862 I=52 E=0

putative rhs family protein

X.species

NP_637009.2 XCC1639

479

1191

S=2464 I=65 E=0

RhsD protein precursor

X.species

YP_364448.1 XCV2717

792

1214

S=2047 I=91 E=0

Rhs family protein

pubmed

1

1193

S=3767 I=66 E=0

Glycinecin R

Pubmed 19107397

 

prodomImg

pubmed

462

1185

S=943 I=36 E=7.39635e-105

Rhs family protein

Pubmed 19025565

 

prodomImg

pubmed

462

1197

S=900 I=35 E=9.56752e-100

Rhs family protein ; Plasmid

Pubmed 17375195

 

prodomImg

pubmed

1

368

S=328 I=29 E=2.01434e-30

Rhs family protein ; Plasmid

Pubmed 17375195

 

prodomImg

pubmed

462

1188

S=891 I=34 E=1.28581e-98

RhsD protein ; Plasmid

Pubmed 18070959

 

prodomImg

sp

481

736

S=199 I=30 E=7.36103e-15

Protein rhsD ; Repeat

 

prodomImg

sp

1074

1192

S=173 I=38 E=9.13089e-12

Protein rhsD ; Repeat

 

prodomImg

sp

544

812

S=138 I=28 E=1.41963e-07

Protein rhsD ; Repeat

 

prodomImg

sp

1074

1191

S=183 I=39 E=5.75693e-13

Putative protein rhsE

 

prodomImg

sp

1074

1189

S=179 I=37 E=1.65332e-12

Putative uncharacterized protein yibJ

 

prodomImg

Iprscan IPR006530 [PF05593]

481

516

YD repeat

Iprscan IPR006530 [PF05593]

531

568

YD repeat

Iprscan IPR006530 [PF05593]

620

648

YD repeat

Iprscan IPR006530 [PF05593]

665

699

YD repeat

Iprscan IPR006530 [PF05593]

686

723

YD repeat

Iprscan IPR006530 [PF05593]

707

741

YD repeat

Iprscan IPR006530 [PF05593]

898

934

YD repeat

Iprscan IPR006530 [TIGR01643]

166

207

YD repeat

Iprscan IPR006530 [TIGR01643]

309

350

YD repeat

Iprscan IPR006530 [TIGR01643]

481

522

YD repeat

Iprscan IPR006530 [TIGR01643]

531

572

YD repeat

Iprscan IPR006530 [TIGR01643]

599

640

YD repeat

Iprscan IPR006530 [TIGR01643]

665

706

YD repeat

Iprscan IPR006530 [TIGR01643]

707

748

YD repeat

Iprscan IPR006530 [TIGR01643]

981

1019

YD repeat

Iprscan [TIGR03696]

1107

1189

-

Iprscan [seg]

440

460

-

Iprscan [seg]

626

637

-

PDA1H942

1030

1137

S=524 I=87 E=9.36586e-56

PDA1E1K7

833

886

S=274 I=96 E=1.95026e-25

PDA378Z4

509

598

S=266 I=57 E=1.89833e-24

PDA7P6K2

713

791

S=260 I=63 E=9.77764e-24

PD781463

919

966

S=215 I=90 E=2.63077e-18

PDA9W602

116

427

S=186 I=28 E=9.29047e-15

PDA1L0R2

792

832

S=185 I=88 E=1.28274e-14

PDA9L4F6

2

164

S=164 I=32 E=4.04792e-12

PDA9G3H3

1

147

S=161 I=31 E=1.16252e-11

PD689381

607

657

S=160 I=65 E=1.32494e-11

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one cw50ymCe)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

141 hits
swiss-prot

Swiss-Prot ncbi-blastp

24 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBalz_Si/XFF4834R_chr25400.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBalz_Si/XFF4834R_chr25400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBalz_Si/XFF4834R_chr25400.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBalz_Si/XFF4834R_chr25400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.