Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr25380XFF4834R_chr25380putative DNA methyltransferase

XFF4834R_chr25380
XFF4834R_chr25370
XFF4834R_chr25370
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25390
XFF4834R_chr25390
ID
AC XFF4834R_chr25380
LT XFF4834R_chr25380
OR XFF4834R_chr from 2928846 to 2929469 on strand -
DE putative DNA methyltransferase
IP Conserved hypothetical protein CHP00095
CL 2.1 DNA related GO:0006259
EC
GO InterPro


Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101104)
MW 22701.9 Da
SQ 207 aa
 
........10........20........30........40........50
| | | | |
MSRPQRPAPRGAEGRVRIVGGRWRNTRLAVPSLPGLRPSSDRVRETVFNW
LMPRLPGARVLDLFAGSGALGLEAVSRGAAHATLIERDPGLVQRLREHVT
RLDAANQVQVLQEDALRWLERAPAALADIVFVDPPFAAGLWPAVLERLPA
HVAVDAWLYLEAPADAPPLLPAGWHLHREGATREVRYALYRRAAATLKSD
PTPVVSV
XFF4834R

XFF4834R_chr29190 rlmL-XFF4834R_chr29190

57

135

S=104 I=35 E=2.66805e-06

23S rRNA mG2445 methyltransferase, SAM-dependent

X.species

NP_642842.1 XAC2527-XAC2527

1

207

S=868 I=86 E=2.0527e-98

hypothetical protein

X.species

YP_364441.1 XCV2710

1

207

S=847 I=84 E=7.19211e-96

putative methyltransferase

X.species

NP_637746.1 XCC2392

1

207

S=729 I=73 E=1.47858e-81

hypothetical protein

X.species

XALc_1944 XALc_1944

10

200

S=553 I=62 E=3.82412e-60

putative methyltransferase protein

X.species

YP_363366.1 XCV1635

57

135

S=109 I=36 E=2.18546e-06

23S rRNA m(2)G2445 methyltransferase

X.species

NP_641926.1 XAC1594-XAC1594

57

135

S=104 I=35 E=9.29186e-06

23S rRNA m(2)G2445 methyltransferase

X.species

NP_636916.2 XCC1545

57

135

S=99 I=33 E=3.58931e-05

23S rRNA m(2)G2445 methyltransferase

pubmed

2

200

S=559 I=61 E=2.64074e-59

Putative uncharacterized protein hyp1

Pubmed 16102911

 

prodomImg

pubmed

5

148

S=328 I=49 E=2.6023e-31

Ribosomal RNA small subunit methyltransferase D EC=2.1.1.52 ; rRNA processing S-adenosyl-L-methionine

Pubmed 3025556,8041620

 

prodomImg

pubmed

1

106

S=262 I=52 E=2.54029e-23

Hypothetical 21.7 kDa protein in ftsY 5' region

Pubmed 8581173

 

prodomImg

pubmed

16

155

S=237 I=40 E=2.64684e-20

Putative uncharacterized protein

Pubmed 16309397

 

prodomImg

pubmed

13

148

S=234 I=30 E=5.60231e-20

Predicted N6-adenine-specific methylase ; Methyltransferase

Pubmed 10988064

 

prodomImg

sp

5

148

S=328 I=49 E=1.77966e-31

Ribosomal RNA small subunit methyltransferase D EC=2.1.1.52 ; rRNA processing S-adenosyl-L-methionine

 

prodomImg

sp

5

148

S=328 I=49 E=1.77966e-31

Ribosomal RNA small subunit methyltransferase D EC=2.1.1.52 ; rRNA processing S-adenosyl-L-methionine

 

prodomImg

sp

12

185

S=300 I=28 E=4.51238e-28

Ribosomal RNA small subunit methyltransferase D EC=2.1.1.52 ; rRNA processing S-adenosyl-L-methionine

 

prodomImg

sp

1

140

S=289 I=42 E=8.97795e-27

Ribosomal RNA small subunit methyltransferase D EC=2.1.1.52 ; rRNA processing S-adenosyl-L-methionine

 

prodomImg

sp

16

140

S=272 I=37 E=8.96296e-25

Ribosomal RNA small subunit methyltransferase D EC=2.1.1.52 ; rRNA processing S-adenosyl-L-methionine

 

prodomImg

Iprscan [G3DSA:3.40.50.150]

37

197

-

Iprscan IPR004398 [PIRSF004553]

6

194

Conserved hypothetical protein CHP00095

Iprscan [PTHR18895]

38

168

-

Iprscan IPR004398 [PF03602]

16

190

Conserved hypothetical protein CHP00095

Iprscan IPR004398 [TIGR00095]

5

193

Conserved hypothetical protein CHP00095

Iprscan [seg]

158

172

-

Iprscan [seg]

186

195

-

PD006760

59

111

S=148 I=57 E=1.71398e-10

PD752094

60

148

S=132 I=34 E=1.50135e-08

PD030986

31

128

S=129 I=35 E=3.46727e-08

PDA1U394

1

29

S=126 I=90 E=7.4031e-08

PDA6X0N0

7

59

S=119 I=47 E=6.10587e-07

PDA6L7I5

13

58

S=106 I=37 E=2.08585e-05

Iprscan [SSF53335]

8

164

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one peRLMMyy)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

11 hits
swiss-prot

Swiss-Prot ncbi-blastp

8 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEbUgek/XFF4834R_chr25380.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEbUgek/XFF4834R_chr25380.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEbUgek/XFF4834R_chr25380.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEbUgek/XFF4834R_chr25380.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.