Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr25370coaDXFF4834R_chr25370pantetheine-phosphate adenylyltransferase

coaD XFF4834R_chr25370
XFF4834R_chr25360
XFF4834R_chr25360
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25380
XFF4834R_chr25380
ID coaD
AC XFF4834R_chr25370
LT XFF4834R_chr25370
OR XFF4834R_chr from 2928343 to 2928849 on strand -
DE pantetheine-phosphate adenylyltransferase
IP Coenzyme A biosynthesis protein; Rossmann-like alpha/beta/alpha sandwich fold
CL 1.5.3.5 Coenzyme A GO:0015937
EC
GO InterPro
Biological Process: biosynthetic process (GO:0009058)
Biological Process: coenzyme A biosynthetic process (GO:0015937)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: nucleotidyltransferase activity (GO:0016779)
Molecular Function: pantetheine-phosphate adenylyltransferase activity (GO:0004595)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: validated by darrasse (20120403)
MW 18269.7 Da
SQ 168 aa
 
........10........20........30........40........50
| | | | |
MSVANSRTAVYPGTFDPITNGHIDLVNRAAPLFERVVVGVAYSPSKGPAL
SLERRVALAQEALAAHANVEVRGFDTLLAHFVREMGAGVLLRGLRAVSDF
EYEFQMASMNRHLIPEVETLFLTPAEQYSFISSSLVREIARLGGDVSGFV
PASVVEALRQVRQSRAQA
Show or not Domain decomposition
 
Hamap COAD_MF_00151 raw_score=4112 norm_score=35.549

Phosphopantetheine adenylyltransferase [coaD].

X.species

YP_364440.1 lcl|coaD-XCV2709

1

168

S=799 I=93 E=4.04139e-90

phosphopantetheine adenylyltransferase

X.species

NP_642841.1 lcl|coaD-XAC2526

1

168

S=799 I=93 E=4.07678e-90

phosphopantetheine adenylyltransferase

X.species

NP_637745.1 lcl|coaD-XCC2391

1

167

S=777 I=91 E=1.74558e-87

phosphopantetheine adenylyltransferase

X.species

lcl|coaD-XALc_1943

1

164

S=688 I=83 E=9.81356e-77

putative phosphopantetheine adenylyltransferase (pantetheine-phosphate adenylyltransferase) (ppat) (dephospho-coa pyrophosphorylase) protein

pubmed

1

164

S=688 I=83 E=3.25762e-75

Putative uncharacterized protein kdtB

Pubmed 16102911

 

prodomImg

pubmed

6

158

S=489 I=58 E=4.5254e-51

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

Pubmed 11371519

 

prodomImg

pubmed

7

159

S=484 I=63 E=1.63032e-50

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

Pubmed 8765743

 

prodomImg

pubmed

6

158

S=482 I=56 E=3.21825e-50

Phosphopantetheine adenyltransferase

Pubmed 12427940

 

prodomImg

pubmed

7

158

S=479 I=57 E=8.25207e-50

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

Pubmed 2033061,8041620

 

prodomImg

pubmed

6

158

S=455 I=59 E=5.96175e-47

CoaD

Pubmed 18310345

 

prodomImg

pubmed

6

158

S=454 I=58 E=9.21933e-47

CoaD

Pubmed 19151135

 

prodomImg

pubmed

9

160

S=424 I=50 E=3.77594e-43

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

Pubmed 12427940

 

prodomImg

pubmed

7

163

S=418 I=50 E=1.92798e-42

Predicted phosphopantetheine adenylyltransferase ; Nucleotidyltransferase

Pubmed 10988064

 

prodomImg

pubmed

9

155

S=404 I=51 E=9.01468e-41

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

Pubmed 18441057

 

prodomImg

sp

1

168

S=799 I=93 E=9.34499e-89

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

 

prodomImg

sp

1

168

S=799 I=93 E=9.42682e-89

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

 

prodomImg

sp

1

168

S=789 I=92 E=1.60317e-87

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

 

prodomImg

sp

1

168

S=789 I=92 E=1.60317e-87

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

 

prodomImg

sp

1

168

S=789 I=92 E=1.60317e-87

Phosphopantetheine adenylyltransferase EC=2.7.7.3 ; ATP-binding Coenzyme biosynthesis Cytoplasm Nucleotide-binding Nucleotidyltransferase

 

prodomImg

Iprscan IPR001980 [PR01020]

7

25

Coenzyme A biosynthesis protein

Iprscan IPR001980 [PR01020]

25

46

Coenzyme A biosynthesis protein

Iprscan IPR001980 [PR01020]

54

78

Coenzyme A biosynthesis protein

Iprscan IPR001980 [PR01020]

90

106

Coenzyme A biosynthesis protein

Iprscan IPR001980 [PR01020]

117

139

Coenzyme A biosynthesis protein

Iprscan IPR014729 [G3DSA:3.40.50.620]

7

164

Rossmann-like alpha/beta/alpha sandwich fold

Iprscan [PTHR21342]

6

167

-

Iprscan [PTHR21342]

6

167

-

Iprscan IPR004820 [PF01467]

10

139

Cytidylyltransferase

Iprscan IPR004821 [TIGR00125]

8

68

Cytidyltransferase-related

Iprscan IPR001980 [TIGR01510]

8

162

Coenzyme A biosynthesis protein

PDA1F710

68

145

S=307 I=74 E=8.51529e-30

PD004081

9

81

S=144 I=43 E=5.51054e-10

Iprscan [SSF52374]

6

168

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hGsK6EbV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

37 hits
swiss-prot

Swiss-Prot ncbi-blastp

574 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcqshrW/XFF4834R_chr25370.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcqshrW/XFF4834R_chr25370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcqshrW/XFF4834R_chr25370.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcqshrW/XFF4834R_chr25370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.