Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr25360XFF4834R_chr27750799_2928296_r2_XFF4834R-XFF4834R_chr25360XFF4834R_chr25360conserved hypothetical protein

XFF4834R_chr27750799_2928296_r2_XFF4834R-XFF4834R_chr25360 XFF4834R_chr25360
XFF4834R_chr25350
XFF4834R_chr25350
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25370
XFF4834R_chr25370
ID XFF4834R_chr27750799_2928296_r2_XFF4834R-XFF4834R_chr25360
AC XFF4834R_chr25360
LT XFF4834R_chr25360
OR XFF4834R_chr from 2927799 to 2928296 on strand -
DE conserved hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN les autres xantho ont mis secreted mais signalP -
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20101011)
MW 17404.7 Da
SQ 165 aa
 
........10........20........30........40........50
| | | | |
MKHTMRALALASIAALAVTACKKEEPAPTAAAAPAPLTAPAKDDNAGWKK
YLQEVVGQNLGTTTNSPFLYYLPPESDAEFAGSYERQLESVKTALARGVQ
PGNMLAFGSSASSKMADLIDAAFKDVAPDSMKGVRVLFIGNAADNARVQT
IVQPKGAEYIFVEAK
X.species

YP_364439.1 lcl|XCV2708

1

165

S=692 I=82 E=3.11434e-77

putative secreted protein

X.species

NP_642840.1 lcl|XAC2525-XAC2525

21

165

S=668 I=89 E=2.65534e-74

hypothetical protein

X.species

NP_637744.1 lcl|XCC2390

21

165

S=651 I=86 E=3.44342e-72

hypothetical protein

X.species

lcl|XALc_1942

21

165

S=527 I=68 E=3.52124e-57

hypothetical secreted signal peptide protein

pubmed

21

165

S=527 I=68 E=1.15958e-55

Putative uncharacterized protein hyp2

Pubmed 16102911

 

prodomImg

Iprscan [PS51257]

1

21

-

Iprscan [seg]

7

20

-

Iprscan [seg]

26

41

-

PD303461

5

165

S=555 I=66 E=9.24965e-60

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one AxwM3pNb)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUddoKS/XFF4834R_chr25360.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUddoKS/XFF4834R_chr25360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUddoKS/XFF4834R_chr25360.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUddoKS/XFF4834R_chr25360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.