Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr25350XFF4834R_chr27750282_2927740_r3_XFF4834R-XFF4834R_chr25350XFF4834R_chr25350Probable ferredoxin

XFF4834R_chr27750282_2927740_r3_XFF4834R-XFF4834R_chr25350 XFF4834R_chr25350
XFF4834R_chr25340
XFF4834R_chr25340
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25360
XFF4834R_chr25360
ID XFF4834R_chr27750282_2927740_r3_XFF4834R-XFF4834R_chr25350
AC XFF4834R_chr25350
LT XFF4834R_chr25350
OR XFF4834R_chr from 2927282 to 2927566 on strand -
DE Probable ferredoxin
IP 4Fe-4S ferredoxin, iron-sulpur binding domain
CL 1.4.3 Electron carrier GO:0009055
EC
GO InterPro
Molecular Function: iron-sulfur cluster binding (GO:0051536)
Molecular Function: electron carrier activity (GO:0009055)

Curated
PM
AN
CC COG: [CS] Energy production and conversion;Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100818)
MW 10422.8 Da
SQ 94 aa
 
........10........20........30........40........50
| | | | |
MSLKINELCVNCDVCEPACPNQAISMGETIYVIDPARCTECVGHFDEAQC
VVVCPVECIDPDPAIPETHDQLLAKLMQLQRDHPELYEQEPPAP
Show or not Domain decomposition
 
X.species

YP_364438.1 lcl|XCV2707

1

94

S=487 I=99 E=6.56605e-53

putative ferredoxin

X.species

NP_642839.1 lcl|XAC2524-XAC2524

1

94

S=481 I=100 E=4.16911e-52

ferredoxin

X.species

NP_637743.1 lcl|XCC2389

1

94

S=477 I=99 E=1.20781e-51

ferredoxin

X.species

lcl|XALc_1941

26

87

S=296 I=92 E=9.53577e-30

hypothetical 4fe-4s ferredoxin, iron-sulfur binding protein

pubmed

1

79

S=250 I=61 E=1.41475e-22

Ferredoxin

Pubmed 8405941

 

prodomImg

pubmed

1

79

S=243 I=58 E=9.4654e-22

Ferredoxin ; 4Fe-4S Electron transport Iron Iron-sulfur Metal-binding Repeat

Pubmed 8765743,893371

 

prodomImg

pubmed

1

47

S=235 I=96 E=9.96542e-21

Putative uncharacterized protein fox

Pubmed 16102911

 

prodomImg

pubmed

1

79

S=225 I=58 E=1.43604e-19

Ferredoxin

Pubmed 9177244

 

prodomImg

pubmed

1

81

S=218 I=52 E=1.03019e-18

Uncharacterized ferredoxin-like protein HI_0527 ; 4Fe-4S Electron transport Iron Iron-sulfur Metal-binding Repeat

Pubmed 10675023

 

prodomImg

sp

1

79

S=243 I=58 E=5.90167e-22

Ferredoxin ; 4Fe-4S Electron transport Iron Iron-sulfur Metal-binding Repeat

 

prodomImg

sp

1

81

S=218 I=52 E=6.42321e-19

Uncharacterized ferredoxin-like protein HI_0527 ; 4Fe-4S Electron transport Iron Iron-sulfur Metal-binding Repeat

 

prodomImg

sp

1

81

S=205 I=50 E=3.0829e-17

Uncharacterized ferredoxin-like protein yfhL ; 4Fe-4S Iron Iron-sulfur Metal-binding Repeat

 

prodomImg

sp

1

59

S=171 I=61 E=3.72231e-13

Ferredoxin-3 ; 4Fe-4S Electron transport Iron Iron-sulfur Metal-binding Repeat

 

prodomImg

sp

1

59

S=167 I=58 E=1.00571e-12

Ferredoxin-1 ; 4Fe-4S Electron transport Iron Iron-sulfur Metal-binding Repeat

 

prodomImg

Iprscan [G3DSA:3.30.70.20]

2

83

-

Iprscan IPR017900 [PS00198]

9

20

4Fe-4S ferredoxin, iron-sulphur binding, conserved site

Iprscan IPR017896 [PS51379]

1

29

4Fe-4S ferredoxin, iron-sulpur binding domain

Iprscan IPR017896 [PS51379]

31

64

4Fe-4S ferredoxin, iron-sulpur binding domain

Iprscan [SSF54862]

4

81

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one CR6ZAB7i)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

30 hits
swiss-prot

Swiss-Prot ncbi-blastp

18 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBs10YWp/XFF4834R_chr25350.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBs10YWp/XFF4834R_chr25350.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBs10YWp/XFF4834R_chr25350.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBs10YWp/XFF4834R_chr25350.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.