Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr25340ggt3XFF4834R_chr25340gamma-glutamyltranspeptidase

ggt3 XFF4834R_chr25340
XFF4834R_chr_2684
XFF4834R_chr_2684
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25350
XFF4834R_chr25350
ID ggt3
AC XFF4834R_chr25340
LT XFF4834R_chr25340
OR XFF4834R_chr from 2925507 to 2927285 on strand -
DE gamma-glutamyltranspeptidase
IP Gamma-glutamyltranspeptidase
CL 1.5.3.10 Glutathione GO:0006750
EC
GO InterPro
Molecular Function: gamma-glutamyltransferase activity (GO:0003840)

Curated
PM
AN Signal peptide predicted by Phobius.
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120326)
MW 62601.3 Da
SQ 592 aa
 
........10........20........30........40........50
| | | | |
MSTFSRRFSSRGVLLLAFVLAPAAWCADAAKPATATTAAVAAHPPGAAIA
SGHALATDAGLQVLREGGNAFDAAVAVSSTLAVVEPISSGLGGGGFFLLH
DAKTGKDVMLDARETAPASATEAQFLDKKGELDRDRSVNGPWSAGIPGLP
AALVELAAKHGRLPLKQSLAPSIRIATEGFPVYARMANGYASRREVMERY
PGTREVYLRGGKPIAEGEIFKQPELAQTLQLLGDKGFDGFYKGETARKLL
AGVKQAGGQWSAAELAGYRVKERAPIQFDYRGWKITTAPPPSSGGIALAA
MLQILEGWDLNTLDDVHRTHLVVESMRRAYRDRTFFLGDPDFVDVPQRVL
TSKDYAQGLRATINPDKATPSDLLSGNPTPLEDDETTHFSIIDGEGNRVG
ATQTVNLLYGSGLIPKGTGVLLNNEMDDFALKPGTPNAFGVMGYAANAPK
PGKRMLSSMTPTFMESADKAIVLGTPGGSRIITMVLLGVLGYDAGLDAQA
VSALPRYHHQWLPDVIEAETDAFSAQTAKGLQAMGHALELPGDTAEGGRG
SSHVWGNLQTVEWDKRSNVLSGGSDPRNPVGKAQVQLDAAAH
XFF4834R

XFF4834R_chr11970 lcl|XFF4834R_chr12560320_1347029_f3_XFF4834R-XFF4834R_chr11970

55

510

S=510 I=33 E=5.81692e-55

XFF4834R

XFF4834R_chr02790 lcl|XFF4834R_chr02920758_0326338_r3_XFF4834R-XFF4834R_chr02790

161

578

S=303 I=29 E=6.90128e-30

XFF4834R

XFF4834R_chr11970 lcl|XFF4834R_chr12560320_1347029_f3_XFF4834R-XFF4834R_chr11970

55

510

S=510 I=33 E=5.81692e-55

XFF4834R

XFF4834R_chr02790 lcl|XFF4834R_chr02920758_0326338_r3_XFF4834R-XFF4834R_chr02790

161

578

S=303 I=29 E=6.90128e-30

pubmed

51

592

S=2253 I=78 E=0

Putative uncharacterized protein ggt

Pubmed 16102911

 

prodomImg

pubmed

54

540

S=885 I=38 E=2.64547e-98

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Periplasm Signal Zymogen

Pubmed 2570061

 

prodomImg

pubmed

55

541

S=877 I=39 E=2.71331e-97

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Periplasm Signal Zymogen

Pubmed 7765305

 

prodomImg

pubmed

51

538

S=860 I=40 E=3.36851e-95

Gamma-glutamyltranspeptidase

Pubmed 14764109

 

prodomImg

pubmed

55

583

S=849 I=39 E=7.12384e-94

Gamma-glutamyl transpeptidase

Pubmed 17991023

 

prodomImg

pubmed

51

538

S=842 I=37 E=5.2004e-93

Gamma-glutamyltranspeptidase

Pubmed 16861657

 

prodomImg

pubmed

51

538

S=842 I=37 E=5.38497e-93

Gamma-glutamyltranspeptidase EC=2.3.2.2 Gamma-glutamyl transpeptidase ; Acyltransferase

Pubmed 17600669

 

prodomImg

pubmed

51

575

S=681 I=33 E=1.44458e-73

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Secreted Signal Zymogen

Pubmed 8763966

 

prodomImg

pubmed

105

540

S=660 I=36 E=5.57087e-71

Uvs048

Pubmed 14532085

 

prodomImg

pubmed

51

536

S=658 I=34 E=1.00787e-70

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Secreted Signal Zymogen

Pubmed 9339568,1371053

 

prodomImg

sp

54

540

S=885 I=38 E=1.8218e-98

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Periplasm Signal Zymogen

 

prodomImg

sp

55

541

S=877 I=39 E=1.86852e-97

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Periplasm Signal Zymogen

 

prodomImg

sp

62

539

S=780 I=40 E=9.37127e-86

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Periplasm Signal Zymogen

 

prodomImg

sp

51

575

S=681 I=33 E=9.94806e-74

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Secreted Signal Zymogen

 

prodomImg

sp

51

536

S=658 I=34 E=6.94071e-71

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Secreted Signal Zymogen

 

prodomImg

Iprscan IPR000101 [PR01210]

69

94

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

143

161

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

161

180

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

259

275

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

289

308

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

386

404

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

410

428

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

451

466

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

474

491

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PTHR11686]

43

582

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PF01019]

62

578

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [TIGR00066]

47

577

Gamma-glutamyltranspeptidase

Iprscan [seg]

13

50

-

Iprscan [seg]

73

84

-

Iprscan [seg]

90

99

-

Iprscan [SignalP-NN(euk)]

1

29

-

PD691723

257

389

S=277 I=46 E=5.27809e-26

PD859962

521

586

S=258 I=71 E=1.10562e-23

PD002629

387

469

S=247 I=55 E=2.21902e-22

PD127336

145

258

S=167 I=38 E=1.15434e-12

PD335414

471

519

S=134 I=50 E=1.18098e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rdQWNuXd)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

68 hits
swiss-prot

Swiss-Prot ncbi-blastp

29 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

16 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5GaQbi/XFF4834R_chr25340.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5GaQbi/XFF4834R_chr25340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5GaQbi/XFF4834R_chr25340.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5GaQbi/XFF4834R_chr25340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.