Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr25310XFF4834R_chr27680813_2922371_r2_XFF4834R-XFF4834R_chr25310XFF4834R_chr25310putative TonB-dependent transporter

XFF4834R_chr27680813_2922371_r2_XFF4834R-XFF4834R_chr25310 XFF4834R_chr25310
XFF4834R_chr25300
XFF4834R_chr25300
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25320
XFF4834R_chr25320
ID XFF4834R_chr27680813_2922371_r2_XFF4834R-XFF4834R_chr25310
AC XFF4834R_chr25310
LT XFF4834R_chr25310
OR XFF4834R_chr from 2919813 to 2922371 on strand -
DE putative TonB-dependent transporter
IP TonB-dependent vitamin B12 receptor; Bacterial TonB-dependent receptor
CL 4.1.B.14 The Outer Membrane Receptor (OMR) Family
EC
GO InterPro
Biological Process: transport (GO:0006810)
Cellular Component: membrane (GO:0016020)
Molecular Function: transporter activity (GO:0005215)
Molecular Function: receptor activity (GO:0004872)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20120326)
MW 93791.3 Da
SQ 852 aa
 
........10........20........30........40........50
| | | | |
MLNKTPLCLAITLTLAAATWSPLVHAAEGAATGGAANAAAIDLERLEVRP
QLEAQERAVDLKRASDAIQDAVASDAMGRYPDKNVAESLQRLPGVSVTRD
QGEGRFVVIRGLDSSLNSVTIDSMTMGTPEDGTRSAPLDVIPSDSTERLK
VVKSPTPDMPGDSIGGAIQVESTSAFDRDGRTLRGSIEASHQSLSGKTSP
KGAFNYSDIFNDTFGVAVGVNYQDREFESDNTEVAYDTFDGGADDDLFAG
EVQRRKYFIERTRMGANLNLDWRPDADNRYYLRTLYSRFDDAETRQRTIF
GLSDGDVSANGDGTYTVADLPADSISKRVRYRTKKEDTMALSVGGENRLS
AATVDYKLGYTKTRERVNDEKEARFNYDGDDLAATVDQRSGIPKLGFSDN
GWQSNEDFVFDRFVIAPTQVDDSERSAQINVRFDGEHSSLKMGVLGRWRE
RDVNVDESELRRGPAIDLSDWTTAAPEHRGGTLGQSIGSDGMRRYWNTSG
DLYSARPQDVGGNLQTSLQDDYKATEDVFATYAMGTWDIGALRMIAGVRV
ENTQFDATGNQVDVAANGRTATVTPREASSSYTNVLPGLHLRYDSGNDWV
LRFAANKTLSRPAFGDVSPRVSINRGDNEVSLGNPDLDPYRSQNLDLSFE
KYIGSTGVISLGVFHKSIDDYIVQTINTDDAEFPGLQVTRSINGDTAKVR
GAEFNWQQTLDFLPEGWNGFLVGASATALDSDFNPGLENRAGDDFTLPRS
SKRIYSGHLGYEKYGFSARVAAVYRSQYLDTIGQSRAYDIYVAPHTQLDF
SMNYQFNSHVSLYLEAQNLLDEPLELYQGIRSRTLQNEEYGRTYALGLKV
AL
XFF4834R

XFF4834R_chr27430 lcl|XFF4834R_chr30020831_3172551_r1_XFF4834R-XFF4834R_chr27430

547

852

S=366 I=33 E=2.42516e-37

XFF4834R

XFF4834R_chr27430 lcl|XFF4834R_chr30020831_3172551_r1_XFF4834R-XFF4834R_chr27430

43

234

S=219 I=28 E=1.36734e-19

XFF4834R

XFF4834R_chr15620 lcl|XFF4834R_chr_1808443_1811115_r1_XFF4834R-XFF4834R_chr15620

522

852

S=328 I=32 E=8.40929e-33

XFF4834R

XFF4834R_chr15620 lcl|XFF4834R_chr_1808443_1811115_r1_XFF4834R-XFF4834R_chr15620

42

227

S=225 I=30 E=2.37021e-20

XFF4834R

XFF4834R_chr07240 lcl|XFF4834R_chr07630117_0837666_f1_XFF4834R-XFF4834R_chr07240

574

852

S=293 I=33 E=1.38972e-28

XFF4834R

XFF4834R_chr07240 lcl|XFF4834R_chr07630117_0837666_f1_XFF4834R-XFF4834R_chr07240

43

311

S=256 I=29 E=4.98989e-24

XFF4834R

XFF4834R_chr21270 lcl|XFF4834R_chr23170366_2471029_f2_XFF4834R-XFF4834R_chr21270

526

852

S=291 I=29 E=2.71948e-28

XFF4834R

XFF4834R_chr21270 lcl|XFF4834R_chr23170366_2471029_f2_XFF4834R-XFF4834R_chr21270

43

401

S=216 I=25 E=3.63048e-19

XFF4834R

XFF4834R_chr40010 lcl|XFF4834R_chr_4619037_4621922_f3_XFF4834R-XFF4834R_chr40010

496

849

S=291 I=29 E=2.96723e-28

XFF4834R

XFF4834R_chr40010 lcl|XFF4834R_chr_4619037_4621922_f3_XFF4834R-XFF4834R_chr40010

58

288

S=259 I=31 E=1.9976e-24

X.species

YP_364433.1 lcl|XCV2702

1

852

S=4121 I=93 E=0

TonB-dependent outer membrane receptor

X.species

NP_642835.1 lcl|cirA-XAC2520

20

852

S=4111 I=95 E=0

TonB-dependent receptor

X.species

NP_637739.1 lcl|cirA-XCC2385

20

852

S=3912 I=89 E=0

TonB-dependent receptor

X.species

NP_638292.1 lcl|fepA-XCC2944

42

852

S=385 I=25 E=3.73572e-39

TonB-dependent receptor

X.species

YP_364983.1 lcl|XCV3252

42

852

S=380 I=25 E=1.71796e-38

TonB-dependent outer membrane receptor

X.species

NP_643430.1 lcl|fepA-XAC3121

42

852

S=368 I=25 E=5.01638e-37

TonB-dependent receptor

X.species

NP_642097.1 lcl|cirA-XAC1769

547

852

S=362 I=33 E=2.34748e-36

TonB-dependent receptor

X.species

NP_642097.1 lcl|cirA-XAC1769

43

234

S=213 I=28 E=3.1651e-18

TonB-dependent receptor

X.species

YP_363532.1 lcl|XCV1801

547

852

S=362 I=33 E=2.45208e-36

TonB-dependent outer membrane receptor

X.species

YP_363532.1 lcl|XCV1801

43

234

S=212 I=28 E=4.04027e-18

TonB-dependent outer membrane receptor

pubmed

42

375

S=398 I=30 E=5.70458e-39

TonB ; Cell membrane box

Pubmed 11302501

 

prodomImg

pubmed

627

848

S=163 I=28 E=1.61444e-10

TonB ; Cell membrane box

Pubmed 11302501

 

prodomImg

pubmed

452

635

S=131 I=25 E=1.05881e-06

TonB ; Cell membrane box

Pubmed 11302501

 

prodomImg

pubmed

799

852

S=265 I=94 E=6.30442e-23

CirA-like protein

Pubmed 14601665

 

prodomImg

pubmed

43

226

S=213 I=30 E=1.22752e-16

FecA ; Cell membrane TonB box

Pubmed 17574998

 

prodomImg

sp

60

170

S=139 I=32 E=7.21563e-08

Colicin I receptor ; Cell membrane outer Ion transport Iron Signal TonB box

 

prodomImg

sp

79

173

S=121 I=32 E=1.39741e-05

Vitamin B12 transporter btuB ; Calcium Cell membrane outer Ion Metal-binding Porin Signal TonB box Transmembrane

 

prodomImg

Iprscan IPR012910 [G3DSA:2.170.130.10]

41

172

TonB-dependent receptor, plug

Iprscan IPR000531 [G3DSA:2.40.170.20]

354

852

TonB-dependent receptor, beta-barrel

Iprscan IPR000531 [PF00593]

587

850

TonB-dependent receptor, beta-barrel

Iprscan IPR012910 [PF07715]

70

167

TonB-dependent receptor, plug

Iprscan IPR010104 [TIGR01782]

43

852

Bacterial TonB-dependent receptor

Iprscan [seg]

5

19

-

Iprscan [seg]

26

40

-

Iprscan [seg]

235

250

-

Iprscan [SignalP-NN(euk)]

1

26

-

PD911072

251

502

S=368 I=36 E=6.23218e-37

PDA1V0Y3

719

790

S=346 I=93 E=3.01489e-34

PDA9A757

500

546

S=224 I=91 E=1.57549e-19

PD481006

61

135

S=160 I=43 E=8.57525e-12

PD461487

44

177

S=151 I=27 E=1.1227e-10

PDA4Y909

105

150

S=151 I=74 E=1.26846e-10

PD420238

149

234

S=150 I=40 E=1.34829e-10

PDA821M7

706

789

S=142 I=40 E=1.35896e-09

PD691497

542

624

S=140 I=44 E=2.25332e-09

PDA1W881

41

69

S=135 I=100 E=8.55379e-09

Iprscan [SSF56935]

57

852

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Mh8Fltn4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

13 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

42 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5IWAOq/XFF4834R_chr25310.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5IWAOq/XFF4834R_chr25310.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5IWAOq/XFF4834R_chr25310.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5IWAOq/XFF4834R_chr25310.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.