Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr25300XFF4834R_chr_2918695_2919816_r1_XFF4834R-XFF4834R_chr25300XFF4834R_chr25300Putative phytase protein

XFF4834R_chr_2918695_2919816_r1_XFF4834R-XFF4834R_chr25300 XFF4834R_chr25300
XFF4834R_chr25290
XFF4834R_chr25290
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25310
XFF4834R_chr25310
ID XFF4834R_chr_2918695_2919816_r1_XFF4834R-XFF4834R_chr25300
AC XFF4834R_chr25300
LT XFF4834R_chr25300
OR XFF4834R_chr from 2918695 to 2919816 on strand -
DE Putative phytase protein
IP NHL repeat. subgroup;
CL 1.8.1 Phosphorous metabolism GO:0006793
EC
GO InterPro


Curated
PM
AN publi xantho oryzae :PhyA, a secreted protein of Xanthomonas oryzae pv. oryzae, is required for optimum virulence and growth on phytic acid as a sole phosphate source.
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120403)
MW 40468.2 Da
SQ 373 aa
 
........10........20........30........40........50
| | | | |
MIPLRTVVQVTLLSAAAALVGCASAPAGREADEALLKDPLLSEARVAHEV
VPEAFITALTPSDNLDSPASWMAPDGRRWVIATAKGTHALVVFDGDSGKR
LRVVGGKGKALGKLDRPNGISVVDDLVFVVERDNRRVQVFSLPDLTPVTA
FGQNELREPYGLWVRKHDGGYEAVVSDNYMSPANKDLPPPLAELGQRFRR
YQLNAAGQGWQARLTQSFGDTSEAGAVRIAESVFGDEANARLMIAEEDVA
VGTQLRDYGMDGRYRGRNVGAGVFKAQAEGIGLFACSDGSGYWIATDQFK
DRSVFQVFDRKTLAHVGAFAGRVTANTDGVWLDQRSDARFPGGVFYALHD
DQAVAAFDWRDIARTLRLKECTP
X.species

YP_364432.1 lcl|XCV2701

1

373

S=1607 I=84 E=0

putative phytase precursor

X.species

NP_642834.1 lcl|XAC2519-XAC2519

29

373

S=1598 I=89 E=0

hypothetical protein

X.species

NP_637738.1 lcl|XCC2384

5

371

S=1469 I=77 E=7.50094e-171

hypothetical protein

pubmed

1

373

S=1530 I=79 E=1.20916e-176

Putative phytase ; Signal

Pubmed 14601665

 

prodomImg

pubmed

66

370

S=141 I=25 E=2.94009e-08

Beta-propeller phytase EC=3.1.3.8 ; Hydrolase

Pubmed 19139877

 

prodomImg

Iprscan [G3DSA:2.120.10.20]

40

367

-

Iprscan IPR013017 [PS51125]

86

96

NHL repeat. subgroup

Iprscan IPR013017 [PS51125]

101

143

NHL repeat. subgroup

Iprscan [PS51257]

1

22

-

Iprscan [seg]

12

28

-

Iprscan [seg]

98

114

-

Iprscan [seg]

256

267

-

Iprscan [SignalP-NN(euk)]

1

18

-

PDA1W0G4

141

373

S=1112 I=91 E=3.11753e-127

PD692078

29

87

S=272 I=85 E=1.98511e-25

Iprscan [SSF50956]

35

370

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one M8m4jvre)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBim4iui/XFF4834R_chr25300.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBim4iui/XFF4834R_chr25300.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBim4iui/XFF4834R_chr25300.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBim4iui/XFF4834R_chr25300.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.