Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr25200XFF4834R_chr27540393_2907716_f3_XFF4834R-XFF4834R_chr25200XFF4834R_chr25200putative integrase IntL fragment

XFF4834R_chr27540393_2907716_f3_XFF4834R-XFF4834R_chr25200 XFF4834R_chr25200
XFF4834R_chr_2669
XFF4834R_chr_2669
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25210
XFF4834R_chr25210
ID XFF4834R_chr27540393_2907716_f3_XFF4834R-XFF4834R_chr25200
AC XFF4834R_chr25200
LT XFF4834R_chr25200
OR XFF4834R_chr from 2907333 to 2907716 on strand +
DE putative integrase IntL fragment
IP
CL 10.1 Partial similarity
EC
GO InterPro


Curated
PM
AN start modification according to frameD prediction with ACUR and low GC. This protein shares homology with another short hypothetical protein in Xav (XCV2691). However it shares partial homology with integrase-recombinase genes in various bacteria including Xanthomonas, but missing the integrase-recombinase functional domain.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20130418)
MW 14389.3 Da
SQ 127 aa
 
........10........20........30........40........50
| | | | |
MASGRDHVDACGVIQRGRRRMRYTPENSGVTAPTPRWLLDQVRDRPRTRH
YSLRTEQASLSWRRRFILASGKRYPVQMSQAEVETFLTRLAIQAQLSGQA
GPSVGGAVVSLPQRIAYRSASRVRRNP
Show or not Domain decomposition
 
X.species

YP_362087.1 XCV0356

1

97

S=264 I=61 E=1.48604e-25

putative integrase

xanc5

X.species

NP_640700.1 int-XAC0344

30

97

S=222 I=68 E=1.73131e-20

phage-related integrase

xanac

X.species

NP_635739.1 XCC0344

30

97

S=218 I=68 E=5.10389e-20

site-specific recombinase

xancp

X.species

YP_364422.1 XCV2691

21

71

S=159 I=69 E=8.78845e-13

hypothetical protein

xanc5

pubmed

21

97

S=285 I=74 E=1.38379e-26

Integrase

Pubmed 15755815

 

prodomImg

pubmed

21

97

S=263 I=70 E=5.97693e-24

Integrase

Pubmed 15755815

 

prodomImg

pubmed

21

98

S=222 I=58 E=7.02439e-19

Site-specific recombinase IntIA

Pubmed 11209061

 

prodomImg

pubmed

30

97

S=218 I=68 E=1.67981e-18

Site-specific recombinase Site-specific recombinase IntIA

Pubmed 11209061

 

prodomImg

pubmed

30

97

S=218 I=68 E=1.89789e-18

Integrase

Pubmed 15755815

 

prodomImg

sp

38

97

S=145 I=50 E=1.03245e-09

Integrase/recombinase ; DNA integration recombination Plasmid

 

prodomImg

sp

38

97

S=145 I=50 E=1.03245e-09

Integrase/recombinase ; DNA integration recombination Plasmid Transposable element

 

prodomImg

sp

38

97

S=145 I=50 E=1.03245e-09

Integrase/recombinase ; DNA integration recombination Plasmid Transposable element

 

prodomImg

PD007240

42

93

S=157 I=60 E=1.30964e-11

PDA603P8

21

45

S=101 I=80 E=7.71656e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one frWZkw6u)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

233 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDNdRG4/XFF4834R_chr25200.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDNdRG4/XFF4834R_chr25200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDNdRG4/XFF4834R_chr25200.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDNdRG4/XFF4834R_chr25200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.