Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr24990fruAXFF4834R_chr24990PTS fructose porter IIBC component, probable

fruA XFF4834R_chr24990
XFF4834R_chr24980
XFF4834R_chr24980
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25000
XFF4834R_chr25000
ID fruA
AC XFF4834R_chr24990
LT XFF4834R_chr24990
OR XFF4834R_chr from 2890203 to 2891924 on strand +
DE PTS fructose porter IIBC component, probable
IP Phosphotransferase system, EIIB component, type 2/3; Phosphotransferase system, EIIC component, type 2
CL 4.4.A Phosphotransferase Systems (PEP-dependent PTS) GO:0009401
EC
GO InterPro
Biological Process: phosphoenolpyruvate-dependent sugar phosphotransferase system (GO:0009401)
Cellular Component: membrane (GO:0016020)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: protein-N(PI)-phosphohistidine-sugar phosphotransferase activity (GO:0008982)
Molecular Function: sugar:hydrogen symporter activity (GO:0005351)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110119)
MW 58073.2 Da
SQ 573 aa
 
........10........20........30........40........50
| | | | |
MSSSIVVIAAGERSTEAVLAAEALRRAATAAGRRVTIEIRSDQGVLGALP
GELANAATQVLVVGDADVDTARFGDAQLVRLSLGAVLDDPAAAIGKLAAH
ADPAVAGNPGGTASGSKRIVAITSCPTGIAHTFMAAEGLQQAAKKLGYQM
RVETQGSVGAQDALTDDEIRAADVVIIAADREVDLARFGGKRVFKSGTKP
AINDGPALINKALADASVQGGATPASATASKGRTGAYKHLMTGVSFMLPF
VTAGGLLIALAFALGGIYAGDDAHQGTLAWSLFQIGAKAGFTLMVPALAG
YIAYSIADRPGIAPGMIGGLVAANLNAGFLGGIIAGFIAGYGVAALNRYI
KLPRNLEGLKPVLILPVLGTLLVGLAMMYVFGQPVADLLAWLTAWLRGMH
GSSALLLGLLLGGMMAFDMGGPVNKAAYAFSTGLIASQVYTPMAAAMVAG
MTPPLGIALATWVFRNRFTAEERGSATAAGVLGLAFVTEGAIPYAARDPL
RTIPALVIGSAVAGAISMTAGAELKAPHGGIFVLLIPNAVTHLLNYVLAL
VVGVVVTAIALRLLKKPVTDVVA
X.species

YP_364412.1 lcl|fruA-XCV2681

1

573

S=2115 I=76 E=0

PTS system, fructose-specific IIBC component (protein-N(pi)-phosphohistidine-sugar phosphotransferase)

X.species

NP_642818.1 lcl|fruA-XAC2503

1

573

S=2077 I=75 E=0

PTS system, fructose-specific IIBC component

X.species

NP_637726.1 lcl|fruA-XCC2372

1

573

S=1955 I=72 E=0

PTS system fructose-specific II BC component

pubmed

1

573

S=1955 I=72 E=0

PTS system fructose-specific EIIBC component EC=2.7.1.69 ; Cell membrane Kinase Phosphotransferase Repeat Sugar transport Transmembrane

Pubmed 1655739

 

prodomImg

pubmed

37

568

S=956 I=43 E=7.39109e-107

PTS system fructose-specific EIIBBC component EC=2.7.1.69 ; Cell membrane Kinase Phosphotransferase Repeat Sugar transport Transmembrane

Pubmed 2254279

 

prodomImg

pubmed

55

573

S=910 I=40 E=3.1844e-101

PTS system fructose-specific EIIBC component EC=2.7.1.69 ; Cell inner membrane Kinase Phosphotransferase Repeat Sugar transport Transmembrane

Pubmed 3076173

 

prodomImg

pubmed

114

534

S=757 I=42 E=9.82951e-83

HI0446-like protein ; Cell membrane Phosphotransferase system Sugar transport Transmembrane

Pubmed 16714566

 

prodomImg

pubmed

103

536

S=677 I=40 E=5.11333e-73

PTS system, fructose C-specific enzyme II, BC component PTS system, fructose-specific enzyme II, BC component ; Transferase

Pubmed 15168170

 

prodomImg

sp

1

573

S=1955 I=72 E=0

PTS system fructose-specific EIIBC component EC=2.7.1.69 ; Cell membrane Kinase Phosphotransferase Repeat Sugar transport Transmembrane

 

prodomImg

sp

37

568

S=956 I=43 E=5.02974e-107

PTS system fructose-specific EIIBBC component EC=2.7.1.69 ; Cell membrane Kinase Phosphotransferase Repeat Sugar transport Transmembrane

 

prodomImg

sp

55

573

S=910 I=40 E=2.16703e-101

PTS system fructose-specific EIIBC component EC=2.7.1.69 ; Cell inner membrane Kinase Phosphotransferase Repeat Sugar transport Transmembrane

 

prodomImg

sp

114

534

S=749 I=42 E=5.96735e-82

PTS system fructose-specific EIIBC component EC=2.7.1.69 ; Cell inner membrane Kinase Phosphotransferase Repeat Sugar transport Transmembrane

 

prodomImg

sp

115

570

S=700 I=39 E=5.30128e-76

PTS system fructose-specific EIIABC component EC=2.7.1.- EC=2.7.1.69 ; Cell membrane Phosphoprotein Phosphotransferase Sugar transport Transmembrane

 

prodomImg

Iprscan IPR003501 [PF02302]

121

210

Phosphotransferase system, EIIB component, type 2/3

Iprscan IPR003353 [TIGR00829]

120

203

Phosphotransferase system, fructose-specific IIB subunit

Iprscan IPR006327 [TIGR01427]

222

565

Phosphotransferase system, fructose IIC component

Iprscan IPR013011 [PS51099]

119

214

Phosphotransferase system, EIIB component, type 2

Iprscan IPR013014 [PS51104]

236

573

Phosphotransferase system, EIIC component, type 2

Iprscan [seg]

15

35

-

Iprscan [seg]

166

184

-

Iprscan [seg]

253

270

-

Iprscan [seg]

327

345

-

Iprscan [seg]

398

421

-

Iprscan [seg]

543

561

-

Iprscan [tmhmm]

247

269

-

Iprscan [tmhmm]

282

304

-

Iprscan [tmhmm]

319

341

-

Iprscan [tmhmm]

362

384

-

Iprscan [tmhmm]

399

421

-

Iprscan [tmhmm]

442

464

-

Iprscan [tmhmm]

474

496

-

Iprscan [tmhmm]

503

522

-

Iprscan [tmhmm]

542

564

-

PD070264

1

89

S=255 I=65 E=2.47955e-23

PDA375U2

90

133

S=209 I=95 E=8.66596e-18

PD430508

238

324

S=186 I=47 E=6.15255e-15

PD132278

471

524

S=152 I=59 E=6.63259e-11

PDA375U3

90

133

S=118 I=60 E=1.08658e-06

PD522501

37

133

S=112 I=42 E=4.70106e-06

PD004040

134

216

S=104 I=43 E=5.40029e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one BcEKyB2u)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

22 hits
swiss-prot

Swiss-Prot ncbi-blastp

26 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

20 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLeScER/XFF4834R_chr24990.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLeScER/XFF4834R_chr24990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLeScER/XFF4834R_chr24990.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLeScER/XFF4834R_chr24990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.