Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr24980fruKXFF4834R_chr249801-phosphofructokinase, probable

fruK XFF4834R_chr24980
XFF4834R_chr24970
XFF4834R_chr24970
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr24990
XFF4834R_chr24990
ID fruK
AC XFF4834R_chr24980
LT XFF4834R_chr24980
OR XFF4834R_chr from 2889094 to 2890050 on strand +
DE 1-phosphofructokinase, probable
IP 1-phosphofructokinase
CL 1.1.1 Carbohydrates/Carbon compounds GO:0016052
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
alcohol group as acceptor (GO:0016773)

Curated
PM
AN fructose and mannose metabolism
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110119)
MW 32998.2 Da
SQ 318 aa
 
........10........20........30........40........50
| | | | |
MSLQAITVTLNPAIDQTIQLEHLQPGAVHRASSVRNDAGGKGINVAACLA
DWGSQVAALGVLGVGNAGVFEALFRERGIADHCQRMAGETRTNLKLVDAR
SNDTTDINLPGLRLGPAHLQGVADHLAPLLRPGLPVVLSGSLPAGLPDDS
WAQLQAQASAAGARVLLDTSGMPLARALDAAREALPYAVKPNRDELAAWT
GRPLNDRGALSAAAHELIARGIQLVVISMGTEGALFVQRDQRLIARPPRL
AHGSSVGAGDAMVAGLAAASLDAATTLEQCARLATAFSMCRLESGDARRI
TPEGVRRAATDVVIEALS
X.species

YP_364411.1 lcl|fruK-XCV2680

1

318

S=1291 I=81 E=2.10287e-149

1-phosphofructokinase

X.species

NP_642817.1 lcl|fruK-XAC2502

1

318

S=1289 I=81 E=3.77145e-149

1-phosphofructokinase (fructose 1-phosphate kinase)

X.species

NP_637725.1 lcl|fruK-XCC2371

1

306

S=1043 I=73 E=2.25727e-119

1-phosphofructokinase

pubmed

1

306

S=1043 I=73 E=9.37712e-118

1-phosphofructokinase EC=2.7.1.56 ; ATP-binding Nucleotide-binding Transferase

Pubmed 1655739

 

prodomImg

pubmed

1

292

S=394 I=38 E=4.68586e-39

1-phosphofructokinase EC=2.7.1.56 ; ATP-binding Nucleotide-binding Transferase

Pubmed 1850730,2254279

 

prodomImg

pubmed

1

250

S=318 I=35 E=7.91594e-30

1-phosphofructokinase EC=2.7.1.56 ; ATP-binding Nucleotide-binding Transferase

Pubmed 1981619

 

prodomImg

pubmed

6

249

S=306 I=33 E=2.27147e-28

HI0447-like protein ; Kinase Transferase

Pubmed 16714566

 

prodomImg

pubmed

38

250

S=288 I=33 E=2.99743e-26

1-phosphofructokinase ; Transferase

Pubmed 16318732

 

prodomImg

sp

1

306

S=1043 I=73 E=6.38505e-118

1-phosphofructokinase EC=2.7.1.56 ; ATP-binding Nucleotide-binding Transferase

 

prodomImg

sp

1

292

S=394 I=38 E=3.19069e-39

1-phosphofructokinase EC=2.7.1.56 ; ATP-binding Nucleotide-binding Transferase

 

prodomImg

sp

6

249

S=326 I=34 E=5.11966e-31

1-phosphofructokinase EC=2.7.1.56 ; ATP-binding Nucleotide-binding Transferase

 

prodomImg

sp

1

250

S=318 I=35 E=5.3901e-30

1-phosphofructokinase EC=2.7.1.56 ; ATP-binding Nucleotide-binding Transferase

 

prodomImg

sp

1

250

S=318 I=35 E=5.3901e-30

1-phosphofructokinase EC=2.7.1.56 ; ATP-binding Nucleotide-binding Transferase

 

prodomImg

Iprscan [G3DSA:3.40.1190.20]

6

288

-

Iprscan [PTHR10584:SF37]

8

306

-

Iprscan [PTHR10584]

8

306

-

Iprscan IPR011611 [PF00294]

9

298

Carbohydrate/purine kinase

Iprscan IPR017583 [TIGR03168]

5

315

1-phosphofructokinase

Iprscan [TIGR03828]

5

315

-

Iprscan IPR002173 [PS00583]

39

63

Carbohydrate/puine kinase, PfkB, conserved site

Iprscan IPR002173 [PS00584]

254

267

Carbohydrate/puine kinase, PfkB, conserved site

Iprscan [seg]

56

69

-

Iprscan [seg]

152

163

-

Iprscan [seg]

174

185

-

Iprscan [seg]

256

274

-

PD706315

239

318

S=273 I=73 E=1.32414e-25

PDA36940

191

238

S=149 I=83 E=1.3191e-10

PDA5E747

191

255

S=136 I=60 E=5.36467e-09

PD715006

7

53

S=127 I=56 E=7.3366e-08

Iprscan [SSF53613]

1

318

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Ke3vGhh8)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

26 hits
swiss-prot

Swiss-Prot ncbi-blastp

60 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxxD81V/XFF4834R_chr24980.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxxD81V/XFF4834R_chr24980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxxD81V/XFF4834R_chr24980.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxxD81V/XFF4834R_chr24980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.