Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr24970fruBXFF4834R_chr24970PTS fructose porter, probable

fruB XFF4834R_chr24970
XFF4834R_chr24960
XFF4834R_chr24960
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr24980
XFF4834R_chr24980
ID fruB
AC XFF4834R_chr24970
LT XFF4834R_chr24970
OR XFF4834R_chr from 2886581 to 2889097 on strand +
DE PTS fructose porter, probable
IP
CL 4.4.A Phosphotransferase Systems (PEP-dependent PTS) GO:0009401
EC
GO InterPro


Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110111)
MW 88549.2 Da
SQ 838 aa
 
........10........20........30........40........50
| | | | |
MSSPSPAPVTPDLVRLRASARDKDDAIAQAAQLLVAAGCVATGYEASMRR
REGLANTFLGHGLAIPHGDGEDRHLVRRDGIAVLQLPDGVEWNPGQITRL
VVGIAAQSDTHITLLRRLTRLIQDPAQLEALFSTDDPNVIVAALTGDRAP
ETSTAPATDLAEAFEWTIAYPSGLHARPATRWAETARGFSARAQVRAGDQ
AADAKSLVGLLQLGLRAGDSITVSAEGSDAAELLKRLRAVMDSLTAQEKA
DAERAAQRRAVPVAGWTPPQAQPAIVGIGASPGVAIGIIHRLRAAQTEVA
DQPVGLGDGGAQLHEALTRTRQQLAAIQDDTQRRLGASDAAIFKAQAELL
NDTDLITRTCQLMVEGHGVAWSWHQAVEQIASGLAALGNPVLAGRAADLR
DVGRRVLAQLDPAAAGAGLTDLPEQPCILLASDLSPSDTANLDTARVLGL
ATAQGGPTSHTAILSRTLGLPALVAAGGQLLEIEDGVTAIIDGSSGRLYI
DPSEQDLDAARTHIAEQQAIREREAAQRALPAETTDGHHIDIGANVNLPD
QVAMALTQGAEGVGLMRTEFLFLESGRTPSEDEQHATYLAMAQALDGRPL
IVRALDIGGDKQVAHLELPHEENPFLGVRGARLLLRRPDLLEPQLRALYR
AAKDGARLSIMFPMITSVPELIALREICARIRADLDAPEVPIGIMIEVPA
AAAQADVLARHADFFSIGTNDLTQYVLAIDRQNPELAAEADSLHPAVLRM
ICSTIEGARKHDRWVGVCGGLAGDAFGASLLAGLGVQELSMTPNDIPAVK
ARLRGAALSQLQQLAEQALACETAEQVRALEAKREDKA
XFF4834R

XFF4834R_chr16590 lcl|ptsI-XFF4834R_chr16590

277

800

S=570 I=32 E=4.71709e-62

PEP-protein phosphotransferase of PTS system (enzyme I)

XFF4834R

XFF4834R_chr21470 lcl|pps-XFF4834R_chr21470

657

796

S=153 I=28 E=1.53338e-11

phosphoenolpyruvate synthase

X.species

NP_642816.1 lcl|fruB-XAC2501

1

838

S=3542 I=87 E=0

multiphosphoryl transfer protein

X.species

YP_364410.1 lcl|fruB-XCV2679

1

838

S=3485 I=85 E=0

multiphosphoryl transfer protein FruB

X.species

NP_637724.1 lcl|fruB-XCC2370

1

838

S=3396 I=83 E=0

multiphosphoryl transfer protein

X.species

NP_643288.1 lcl|ptsI-XAC2979

277

800

S=576 I=32 E=3.16806e-62

phosphotransferase system enzyme I

X.species

YP_364856.1 lcl|ptsI-XCV3125

277

800

S=570 I=32 E=1.52182e-61

enzyme I of the phosphotransferase system

X.species

NP_638157.1 lcl|ptsI-XCC2809

277

800

S=570 I=32 E=1.71939e-61

phosphotransferase system enzyme I

X.species

lcl|XALc_2146

428

800

S=558 I=37 E=4.14429e-60

putative phosphotransferase system (pts), enzymeIprotein

X.species

lcl|ppsA-XALc_1645

599

796

S=165 I=28 E=1.83249e-12

probable phosphoenolpyruvate synthase protein

X.species

lcl|ppsA-XALc_1645

425

499

S=107 I=37 E=2.05833e-05

probable phosphoenolpyruvate synthase protein

X.species

YP_363933.1 lcl|ppsA-XCV2202

657

796

S=153 I=28 E=5.94098e-11

phosphoenolpyruvate synthase

X.species

NP_642367.1 lcl|ppsA-XAC2041

657

796

S=152 I=28 E=6.31485e-11

phosphoenolpyruvate synthase

X.species

NP_637522.1 lcl|ppsA-XCC2166

619

796

S=152 I=27 E=7.19716e-11

phosphoenolpyruvate synthase

X.species

lcl|XALc_2145

165

235

S=101 I=32 E=9.71656e-05

putative phosphotransferase system (pts), hpr enzyme protein

pubmed

1

838

S=3396 I=83 E=0

Multiphosphoryl transfer protein EC=2.7.3.9 EC=2.7.1.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

Pubmed 7496537

 

prodomImg

pubmed

8

799

S=1355 I=41 E=5.31776e-155

Multiphosphoryl transfer protein EC=2.7.3.9 EC=2.7.1.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

Pubmed 2193161

 

prodomImg

pubmed

277

800

S=874 I=36 E=1.08173e-96

Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) ; Magnesium Metal-binding Transferase

Pubmed 15670601

 

prodomImg

pubmed

277

798

S=804 I=34 E=3.22343e-88

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 7686067

 

prodomImg

pubmed

275

796

S=795 I=34 E=3.48364e-87

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

Pubmed 1551842

 

prodomImg

sp

1

838

S=3396 I=83 E=0

Multiphosphoryl transfer protein EC=2.7.3.9 EC=2.7.1.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

 

prodomImg

sp

8

799

S=1355 I=41 E=3.62112e-155

Multiphosphoryl transfer protein EC=2.7.3.9 EC=2.7.1.- ; Cytoplasm Kinase Phosphotransferase system Sugar transport

 

prodomImg

sp

275

798

S=822 I=35 E=1.3376e-90

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

 

prodomImg

sp

275

796

S=808 I=34 E=7.70995e-89

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

 

prodomImg

sp

277

798

S=804 I=34 E=2.19499e-88

Phosphoenolpyruvate-protein phosphotransferase EC=2.7.3.9 ; Cytoplasm Kinase Magnesium Metal-binding system Sugar transport

 

prodomImg

PD000940

540

800

S=377 I=35 E=4.32068e-38

PD552666

425

508

S=228 I=51 E=5.20132e-20

PD933324

140

249

S=195 I=40 E=5.80614e-16

PD554617

265

310

S=166 I=70 E=1.87922e-12

PDA6H7Q3

681

732

S=164 I=63 E=3.28333e-12

PD592409

424

612

S=162 I=26 E=5.63738e-12

PDA1S479

135

170

S=161 I=89 E=5.88857e-12

PD190342

312

409

S=147 I=35 E=3.45389e-10

PD715246

421

499

S=143 I=41 E=9.7477e-10

PDA0X3V0

533

611

S=136 I=37 E=8.03963e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one GW2b4ZJz)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

92 hits
swiss-prot

Swiss-Prot ncbi-blastp

123 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzdeHuq/XFF4834R_chr24970.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzdeHuq/XFF4834R_chr24970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzdeHuq/XFF4834R_chr24970.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBzdeHuq/XFF4834R_chr24970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.