Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr24740XFF4834R_chr27060889_2855026_r3_acur-XFF4834R_chr24740XFF4834R_chr24740hypothetical protein

XFF4834R_chr27060889_2855026_r3_acur-XFF4834R_chr24740 XFF4834R_chr24740
XFF4834R_chr24730
XFF4834R_chr24730
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_2627
XFF4834R_chr_2627
ID XFF4834R_chr27060889_2855026_r3_acur-XFF4834R_chr24740
AC XFF4834R_chr24740
LT XFF4834R_chr24740
OR XFF4834R_chr from 2854889 to 2855026 on strand -
DE hypothetical protein
IP
CL 10.1 Partial similarity
EC
GO InterPro


Curated
PM
AN homologie partielle avec Xoryzp_09650
CC COG: []
CC MODEL: acur
CC STATUS: curated by jacques (20101112)
MW 4968.8 Da
SQ 45 aa
 
........10........20........30........40........50
| | | | |
MGIGRALQHCKALESIANRQGSPMMRQTTASWAWSVSLPISQRVI
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1sr1n2gN)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNUHFfw/XFF4834R_chr24740.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNUHFfw/XFF4834R_chr24740.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNUHFfw/XFF4834R_chr24740.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNUHFfw/XFF4834R_chr24740.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.