Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr23970sodMXFF4834R_chr23970superoxide dismutase, Mn

sodM XFF4834R_chr23970
XFF4834R_chr23960
XFF4834R_chr23960
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23980
XFF4834R_chr23980
ID sodM
AC XFF4834R_chr23970
LT XFF4834R_chr23970
OR XFF4834R_chr from 2763915 to 2764526 on strand -
DE superoxide dismutase, Mn
IP Manganese/iron superoxide dismutase
CL 5.5.6 Other stresses (mechanical, nutritional, oxidative) GO:0009612 GO:0007584 GO:0006979
EC
GO InterPro
Biological Process: superoxide metabolic process (GO:0006801)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: metal ion binding (GO:0046872)
Molecular Function: superoxide dismutase activity (GO:0004784)

Curated
PM
AN
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100727)
MW 22717.2 Da
SQ 203 aa
 
........10........20........30........40........50
| | | | |
MAYTLPQLPYAYDALEPNIDAQTMEIHHTKHHQTYINNVNAALEGTEYAD
LPIEELVSKLKSLPENLQGPVRNNGGGHANHSLFWTVLSPNGGGEPKGEV
AKAIDKDLGGFEKFKEAFTKAAVSRFGSGWAWLSVTPDKKLVVESTANQD
SPLFEGNTPILGLDVWEHAYYLKYQNRRPEYIGAFYNAVNWEEVERRYHA
AIA
XFF4834R

XFF4834R_chr26730 lcl|sodB-XFF4834R_chr26730

8

197

S=408 I=41 E=3.18239e-43

superoxide dismutase, Fe

X.species

NP_642702.1 lcl|sodM-XAC2386

1

203

S=1080 I=100 E=4.38233e-124

superoxidase dismutase

X.species

YP_364314.1 lcl|sodM-XCV2583

1

203

S=1077 I=100 E=9.94573e-124

superoxidase dismutase

X.species

NP_637633.1 lcl|sodM-XCC2278

1

203

S=1059 I=96 E=1.78077e-121

superoxide dismutase

X.species

lcl|sodA-XALc_1115

1

202

S=923 I=83 E=4.31335e-105

probable manganese and iron superoxide dismutase protein

X.species

NP_635789.1 lcl|sodM-XCC0395

1

201

S=506 I=49 E=1.55679e-54

superoxidase dismutase

X.species

lcl|sodA-XALc_1651

3

202

S=487 I=46 E=3.06797e-52

probable superoxide dismutase protein

X.species

YP_364558.1 lcl|sodB-XCV2827

8

197

S=414 I=41 E=2.12981e-43

superoxide dismutase

X.species

NP_642988.1 lcl|sodB-XAC2677

8

197

S=413 I=41 E=3.29356e-43

iron superoxide dismutase

X.species

NP_637851.1 lcl|sodB-XCC2501

8

197

S=399 I=39 E=1.4114e-41

iron superoxide dismutase

X.species

lcl|sodB-XALc_1274

1

194

S=361 I=42 E=5.38667e-37

probable superoxide dismutase protein

pubmed

1

203

S=1059 I=96 E=6.93532e-120

Superoxide dismutase [Mn] EC=1.15.1.1 ; Manganese Metal-binding Oxidoreductase

Pubmed 8810073

 

prodomImg

pubmed

2

203

S=895 I=81 E=5.25071e-100

Superoxide dismutase [Mn/Fe] EC=1.15.1.1 ; Iron Manganese Metal-binding Oxidoreductase

Pubmed 1848999,1906419

 

prodomImg

pubmed

1

203

S=840 I=74 E=2.40259e-93

Superoxide dismutase [Mn] EC=1.15.1.1 ; Manganese Metal-binding Oxidoreductase

Pubmed 8244935,8806672

 

prodomImg

pubmed

1

203

S=784 I=69 E=1.13838e-86

Superoxide dismutase EC=1.15.1.1 ; Oxidoreductase

Pubmed 12867441

 

prodomImg

pubmed

1

203

S=730 I=67 E=4.18879e-80

Superoxide dismutase [Mn] EC=1.15.1.1 ; Manganese Metal-binding Oxidoreductase Phosphoprotein

Pubmed 2407726,7397109

 

prodomImg

sp

1

203

S=1059 I=96 E=4.7459e-120

Superoxide dismutase [Mn] EC=1.15.1.1 ; Manganese Metal-binding Oxidoreductase

 

prodomImg

sp

1

203

S=1059 I=96 E=4.7459e-120

Superoxide dismutase [Mn] EC=1.15.1.1 ; Manganese Metal-binding Oxidoreductase

 

prodomImg

sp

2

203

S=895 I=81 E=3.5931e-100

Superoxide dismutase [Mn/Fe] EC=1.15.1.1 ; Iron Manganese Metal-binding Oxidoreductase

 

prodomImg

sp

1

202

S=852 I=76 E=5.77982e-95

Superoxide dismutase [Mn] EC=1.15.1.1 ; Manganese Metal-binding Oxidoreductase

 

prodomImg

sp

1

203

S=840 I=74 E=1.64411e-93

Superoxide dismutase [Mn] EC=1.15.1.1 ; Manganese Metal-binding Oxidoreductase

 

prodomImg

Iprscan IPR001189 [PR01703]

72

85

Manganese/iron superoxide dismutase

Iprscan IPR001189 [PR01703]

125

133

Manganese/iron superoxide dismutase

Iprscan IPR001189 [PR01703]

162

174

Manganese/iron superoxide dismutase

Iprscan IPR001189 [PR01703]

6

17

Manganese/iron superoxide dismutase

Iprscan IPR001189 [PR01703]

27

40

Manganese/iron superoxide dismutase

Iprscan IPR001189 [PIRSF000349]

1

203

Manganese/iron superoxide dismutase

Iprscan IPR001189 [PTHR11404]

1

202

Manganese/iron superoxide dismutase

Iprscan [PTHR11404:SF9]

1

202

-

Iprscan IPR019831 [PF00081]

2

89

Manganese/iron superoxide dismutase, N-terminal

Iprscan IPR019832 [PF02777]

94

198

Manganese/iron superoxide dismutase, C-terminal

Iprscan IPR019833 [PS00088]

164

171

Manganese/iron superoxide dismutase, binding site

PD583305

1

85

S=295 I=64 E=3.07921e-28

PD000475

161

201

S=170 I=76 E=3.74865e-13

PDA1U0U2

134

160

S=136 I=100 E=4.40928e-09

PDA090D2

100

133

S=129 I=71 E=3.73303e-08

PDA1J7H5

134

160

S=112 I=81 E=4.03102e-06

PDA1U0U3

133

160

S=111 I=75 E=5.81364e-06

PDA222K6

3

198

S=108 I=24 E=1.24129e-05

PDA6A3A9

134

160

S=102 I=78 E=7.54537e-05

PDA0O4T9

29

156

S=101 I=29 E=7.74533e-05

Iprscan IPR019832 [SSF54719]

88

202

Manganese/iron superoxide dismutase, C-terminal

Iprscan IPR019831 [SSF46609]

1

90

Manganese/iron superoxide dismutase, N-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one p0h2iwLT)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

229 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqAgJPg/XFF4834R_chr23970.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqAgJPg/XFF4834R_chr23970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqAgJPg/XFF4834R_chr23970.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqAgJPg/XFF4834R_chr23970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.