Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr23910efpXFF4834R_chr23910probable elongation factor EF-P

efp XFF4834R_chr23910
XFF4834R_chr23900
XFF4834R_chr23900
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23920
XFF4834R_chr23920
ID efp
AC XFF4834R_chr23910
LT XFF4834R_chr23910
OR XFF4834R_chr from 2757102 to 2757668 on strand -
DE probable elongation factor EF-P
IP Translation elongation factor P/YeiP
CL 2.3.2 Translation GO:0006412
EC
GO InterPro
Biological Process: translational elongation (GO:0006414)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: translation elongation factor activity (GO:0003746)

Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100813)
MW 20893.6 Da
SQ 188 aa
 
........10........20........30........40........50
| | | | |
MATVGMNDVKNGMKILVNNEPAVITETEYVKPGKGQAFTRMKYRFIKSGR
VVEMTMKATDDVEVADVVDTDMRYLYSDGEYWHFMDPETFEQVQTDKAGM
GGADKWLKGEEDCIVTLWNGTPIWVQPPNFVELKITETDPGVRGDTSGGG
GKPATLETGAVVRVPLFVNQDEIIKVDTRSGEYSARVK
XFF4834R

XFF4834R_chr19940 lcl|XFF4834R_chr_2288374_2288940_r1_XFF4834R-XFF4834R_chr19940

74

186

S=149 I=32 E=6.73837e-12

predicted elongtion factor

X.species

YP_364308.1 lcl|efP2-XCV2577

1

188

S=905 I=93 E=6.27862e-103

elongation factor P

X.species

NP_642696.1 lcl|efP-XAC2380

1

188

S=902 I=92 E=1.56837e-102

elongation factor P

X.species

NP_637627.1 lcl|efP-XCC2272

1

188

S=886 I=89 E=1.30378e-100

elongation factor P

X.species

lcl|efp-XALc_1921

1

188

S=801 I=80 E=2.40116e-90

probable elongation factor p protein

X.species

NP_637195.1 lcl|yeiP-XCC1830

7

186

S=160 I=28 E=1.34502e-12

elongation factor P

X.species

lcl|XALc_1330

7

187

S=159 I=26 E=1.62941e-12

putative elongation factor p-like protein.

X.species

YP_363626.1 lcl|efP1-XCV1895

7

186

S=154 I=28 E=6.74887e-12

elongation factor P

X.species

NP_642175.1 lcl|yeiP-XAC1849

7

186

S=153 I=28 E=9.15712e-12

elongation factor P

pubmed

28

166

S=655 I=90 E=4.45533e-71

Elongation factor P

Pubmed 18943306

 

prodomImg

pubmed

33

162

S=610 I=89 E=1.51692e-65

Elongation factor P

Pubmed 19654364

 

prodomImg

pubmed

33

162

S=607 I=89 E=2.89178e-65

Elongation factor P

Pubmed 19654364

 

prodomImg

pubmed

33

162

S=607 I=89 E=2.89178e-65

Elongation factor P

Pubmed 19654364

 

prodomImg

pubmed

33

162

S=607 I=89 E=2.89178e-65

Elongation factor P

Pubmed 19654364

 

prodomImg

sp

1

188

S=905 I=93 E=1.64252e-101

Elongation factor P ; Cytoplasm Protein biosynthesis

 

prodomImg

sp

1

188

S=902 I=92 E=4.10293e-101

Elongation factor P ; Cytoplasm Protein biosynthesis

 

prodomImg

sp

1

188

S=901 I=92 E=5.0579e-101

Elongation factor P ; Cytoplasm Protein biosynthesis

 

prodomImg

sp

1

188

S=886 I=89 E=3.41076e-99

Elongation factor P ; Cytoplasm Protein biosynthesis

 

prodomImg

sp

1

188

S=886 I=89 E=3.41076e-99

Elongation factor P ; Cytoplasm Protein biosynthesis

 

prodomImg

Iprscan IPR014722 [G3DSA:2.30.30.30]

3

63

Translation protein SH3-like, subgroup

Iprscan IPR012340 [G3DSA:2.40.50.140]

66

129

Nucleic acid-binding, OB-fold

Iprscan IPR012340 [G3DSA:2.40.50.140]

130

187

Nucleic acid-binding, OB-fold

Iprscan IPR020599 [PIRSF005901]

1

188

Translation elongation factor P/YeiP

Iprscan IPR015365 [PF09285]

131

186

Elongation factor P, C-terminal

Iprscan IPR013185 [PF08207]

6

62

Translation elongation factor, KOW-like

Iprscan IPR001059 [PF01132]

70

123

Translation elongation factor P/YeiP, central

Iprscan IPR015365 [SM00841]

131

186

Elongation factor P, C-terminal

Iprscan IPR011768 [TIGR00038]

4

187

Translation elongation factor P

Iprscan IPR013852 [PS01275]

152

171

Translation elongation factor P/YeiP, conserved site

PD002832

1

124

S=242 I=42 E=6.92678e-22

PD571341

122

188

S=229 I=66 E=2.62727e-20

Iprscan IPR008991 [SSF50104]

3

65

Translation protein SH3-like

Iprscan IPR016027 [SSF50249]

66

129

Nucleic acid-binding, OB-fold-like

Iprscan IPR016027 [SSF50249]

130

187

Nucleic acid-binding, OB-fold-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Y0rARFxY)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

149 hits
swiss-prot

Swiss-Prot ncbi-blastp

826 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfbee3M/XFF4834R_chr23910.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfbee3M/XFF4834R_chr23910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfbee3M/XFF4834R_chr23910.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBfbee3M/XFF4834R_chr23910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.