Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr23680XFF4834R_chr25870345_2737506_f1_acur-XFF4834R_chr23680XFF4834R_chr23680hypothetical protein

XFF4834R_chr25870345_2737506_f1_acur-XFF4834R_chr23680 XFF4834R_chr23680
XFF4834R_chr23670
XFF4834R_chr23670
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_2519
XFF4834R_chr_2519
ID XFF4834R_chr25870345_2737506_f1_acur-XFF4834R_chr23680
AC XFF4834R_chr23680
LT XFF4834R_chr23680
OR XFF4834R_chr from 2737345 to 2737506 on strand +
DE hypothetical protein
IP
CL 10.1 Partial similarity
EC
GO InterPro


Curated
PM
AN acur et increased sensitivity start et stop present mauvaises homologies partielles sauf avec 2517 d'ou conservation
CC COG: [S] Function unknown;
CC MODEL: acur
CC STATUS: curated by jacques (20101112)
MW 5466.3 Da
SQ 53 aa
 
........10........20........30........40........50
| | | | |
MCGSTRYWCLSAGSRVADLLTHGKLARSGAAITLAAEPFCGAVRCADRPI
IGA
XFF4834R

XFF4834R_chr23670 lcl|XFF4834R_chr25870079_2737255_f2_XFF4834R-XFF4834R_chr23670

1

30

S=128 I=83 E=4.79484e-10

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rcNjsVRb)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiaxQgb/XFF4834R_chr23680.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiaxQgb/XFF4834R_chr23680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiaxQgb/XFF4834R_chr23680.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiaxQgb/XFF4834R_chr23680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.