Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr23580XFF4834R_chr25790042_2729194_f2_acur-XFF4834R_chr23580XFF4834R_chr23580hypothetical protein

XFF4834R_chr25790042_2729194_f2_acur-XFF4834R_chr23580 XFF4834R_chr23580
XFF4834R_chr23570
XFF4834R_chr23570
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23590
XFF4834R_chr23590
ID XFF4834R_chr25790042_2729194_f2_acur-XFF4834R_chr23580
AC XFF4834R_chr23580
LT XFF4834R_chr23580
OR XFF4834R_chr from 2729042 to 2729194 on strand +
DE hypothetical protein
IP
CL 10.1 Partial similarity
EC
GO InterPro


Curated
PM
AN similarite partielle avec Xcc sur ncbi
CC COG: [S] Function unknown;
CC MODEL: acur
CC STATUS: curated by brin (20100924)
MW 5435.2 Da
SQ 50 aa
 
........10........20........30........40........50
| | | | |
MTPNEKTQPGGWVFDVGTANAPAYPAKMWDSGRRAREVMPEAIRAALVSC
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Y3Tn2DIC)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTkE6B1/XFF4834R_chr23580.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTkE6B1/XFF4834R_chr23580.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTkE6B1/XFF4834R_chr23580.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTkE6B1/XFF4834R_chr23580.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.