Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr23570argFXFF4834R_chr23570N-acetyl ornithine carbamoyltransferase

argF XFF4834R_chr23570
XFF4834R_chr23560
XFF4834R_chr23560
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23580
XFF4834R_chr23580
ID argF
AC XFF4834R_chr23570
LT XFF4834R_chr23570
OR XFF4834R_chr from 2727925 to 2728950 on strand -
DE N-acetyl ornithine carbamoyltransferase
IP Aspartate/ornithine carbamoyltransferase, Asp/Orn-binding region; Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding
CL 1.7.13 Amino acid conversion GO:0006520
EC
GO InterPro
Biological Process: cellular amino acid metabolic process (GO:0006520)
Molecular Function: amino acid binding (GO:0016597)
Molecular Function: carboxyl- or carbamoyltransferase activity (GO:0016743)

Curated
PM
AN chgt nom cf publi fonctionnel chez Xcc
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110221)
MW 38065.1 Da
SQ 341 aa
 
........10........20........30........40........50
| | | | |
MSLKHFLNTQDWSRAELDALLTQAALFKRNKLGSELKGKSIALVFFNPSM
RTRTSFELGAFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVAR
VLGRYVDLIGVRAFPKFVDWSKDREDQVLKSFAKYSPVPVINMETITHPC
QELAHALALQEHFGTQDLRGKKYVLTWTYHPKPLNTAVANSALTIATRMG
MDVTLLCPTPDYILDQRYMDWAAQNVAESGGSLQVSHDIDSAYAGADVVY
AKSWGALPFFGNWEPEKPIRDQYQHFIVDERKMALTNNGVFSHCLPLRRN
VKATDAVMDSPNCIAIDEAENRLHVQKAIMAALVGQGSRDS
X.species

YP_364282.1 lcl|argF-XCV2551

1

340

S=1810 I=98 E=0

N-acetylornithine carbamoyltransferase

X.species

NP_637604.1 lcl|argF-XCC2249

1

336

S=1807 I=99 E=0

N-acetylornithine carbamoyltransferase

X.species

NP_642668.1 lcl|argF-XAC2352

1

337

S=1805 I=99 E=0

N-acetylornithine carbamoyltransferase

X.species

lcl|argF-XALc_1896

1

341

S=1754 I=94 E=0

probable ornithine carbamoyltransferase, chain f protein

X.species

lcl|PyrB-XALc_2155

3

335

S=126 I=25 E=3.30765e-08

putative aspartate carbamoyltransferase, catalytic subunit protein

pubmed

1

336

S=1807 I=99 E=0

N-acetylornithine carbamoyltransferase EC=2.1.3.9 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 15731101

 

prodomImg

pubmed

3

334

S=476 I=36 E=4.84331e-49

N-acetylornithine carbamoyltransferase EC=2.1.3.9 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 12095263

 

prodomImg

pubmed

4

335

S=451 I=38 E=6.3859e-46

Ornithine carbamoyltransferase EC=2.1.3.3 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 9288929,9288930

 

prodomImg

pubmed

3

334

S=446 I=32 E=2.12696e-45

Putative ornithine carbamoyltransferase

Pubmed 18048332

 

prodomImg

pubmed

3

330

S=401 I=34 E=6.75385e-40

Ornithine carbamoyltransferase EC=2.1.3.3 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 17563350

 

prodomImg

pubmed

3

335

S=386 I=36 E=3.85913e-38

Ornithine carbamoyltransferase, chloroplastic EC=2.1.3.3 ; Amino-acid biosynthesis Arginine Plastid Transit peptide

Pubmed 10561504

 

prodomImg

pubmed

36

335

S=360 I=36 E=5.9012e-35

Ornithine carbamoyltransferase EC=2.1.3.3 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 17350933

 

prodomImg

pubmed

3

336

S=356 I=33 E=1.72457e-34

Ornithine carbamoyltransferase, chloroplastic EC=2.1.3.3 ; Amino-acid biosynthesis Arginine Plastid Transit peptide

Pubmed 8914525

 

prodomImg

pubmed

4

337

S=352 I=33 E=5.64476e-34

Ornithine carbamoyltransferase EC=2.1.3.3 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 2117745,8025667

 

prodomImg

pubmed

4

336

S=352 I=31 E=5.89628e-34

Ornithine carbamoyltransferase EC=2.1.3.3 Ornithine carbamoyltransferase OOCT1

Pubmed 10987149

 

prodomImg

sp

1

336

S=1807 I=99 E=0

N-acetylornithine carbamoyltransferase EC=2.1.3.9 ; Amino-acid biosynthesis Arginine Cytoplasm

 

prodomImg

sp

1

337

S=1805 I=99 E=0

N-acetylornithine carbamoyltransferase EC=2.1.3.9 ; Amino-acid biosynthesis Arginine Cytoplasm

 

prodomImg

sp

1

336

S=1571 I=84 E=0

N-acetylornithine carbamoyltransferase EC=2.1.3.9 ; Amino-acid biosynthesis Arginine Cytoplasm

 

prodomImg

sp

1

336

S=1567 I=84 E=0

N-acetylornithine carbamoyltransferase EC=2.1.3.9 ; Amino-acid biosynthesis Arginine Cytoplasm

 

prodomImg

sp

3

334

S=476 I=36 E=3.33515e-49

N-acetylornithine carbamoyltransferase EC=2.1.3.9 ; Amino-acid biosynthesis Arginine Cytoplasm

 

prodomImg

Iprscan [G3DSA:3.40.50.1370]

3

149

-

Iprscan [G3DSA:3.40.50.1370]

151

336

-

Iprscan IPR006132 [PF02729]

4

162

Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding

Iprscan IPR006131 [PF00185]

187

333

Aspartate/ornithine carbamoyltransferase, Asp/Orn-binding region

PD816676

143

261

S=359 I=57 E=5.3049e-36

PD919839

74

142

S=282 I=75 E=9.86373e-27

PD000708

4

76

S=150 I=41 E=1.05273e-10

PD409592

282

335

S=112 I=42 E=4.12428e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one fUGJjitQ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

120 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB308dli/XFF4834R_chr23570.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB308dli/XFF4834R_chr23570.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB308dli/XFF4834R_chr23570.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB308dli/XFF4834R_chr23570.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.