Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr23450XFF4834R_chr25620609_2714735_r2_XFF4834R-XFF4834R_chr23450XFF4834R_chr23450hypothetical alpha-amino acid ester hydrolase

XFF4834R_chr25620609_2714735_r2_XFF4834R-XFF4834R_chr23450 XFF4834R_chr23450
XFF4834R_chr_4680
XFF4834R_chr_4680
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23460
XFF4834R_chr23460
ID XFF4834R_chr25620609_2714735_r2_XFF4834R-XFF4834R_chr23450
AC XFF4834R_chr23450
LT XFF4834R_chr23450
OR XFF4834R_chr from 2712609 to 2714522 on strand -
DE hypothetical alpha-amino acid ester hydrolase
IP CocE/NonD hydrolase; Galactose-binding domain-like
CL 1 Metabolism GO:0008152
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: dipeptidyl-peptidase activity (GO:0008239)
Molecular Function: hydrolase activity (GO:0016787)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100924)
MW 70890.7 Da
SQ 637 aa
 
........10........20........30........40........50
| | | | |
MRRLATCLLATAIAAASGSAWAQTPPMTPDITGKPFVAADASNDYIKREV
MIPMRDGVKLHTVIVLPKGAKNAPIVLTRTPYDASGRTERLASPHMKDLL
SVGDDVFVEGGYIRVFQDVRGKYGSEGDYVMTRPLRGPLNPSEVDHATDA
WDTIDWLVKNVSESNGKVGMIGSSYEGFTVVMALTNPHPALKVAVPESPM
IDGWMGDDWFNYGAFRQVNFDYFTGQLSKRGKGAGIARQGHDDYSNFLQA
GSAGDFAKAAGLEQLPWWHKLTEHAAYDAFWQEQALDKVMARTPLKVPTM
WLQGLWDQEDMWGAIHSYAAMEPRDKRNTLNYLVIGPWRHSQVNYDGSAL
GALNFEGDTARQFRHDVLRPFFDQYLVDGAPKADTPPVFIYNTGENHWDR
LKAWPRSCDKGCASASKPLYLQAGGKLSFQPPVAGQAGFEEYVSDPAKPV
PFVPRPVDFSDRAMWTTWLVHDQRFVDGRPDVLTFVTEPLTEPLQIAGAP
EVHLQASSSGSDSDWVVKLIDVYPEEMASNPKMGGYELPVSLAIFRGRYR
ESFSTPKPLASNQPLAFQFGLPTANHTFQPGHRVMVQVQSSLFPLYDRNP
QTYVPNIFFAKPGDYQKATQRVYVSPEQPSYISLPVR
X.species

NP_642657.1 gaa-XAC2341

26

637

S=3252 I=99 E=0

glutaryl-7-ACA acylase precursor

X.species

YP_364270.1 XCV2539

26

637

S=3219 I=98 E=0

putative alpha-amino acid ester hydrolase

X.species

NP_637592.1 gaa-XCC2237

26

637

S=3091 I=93 E=0

glutaryl-7-ACA acylase precursor

X.species

XALc_1885 XALc_1885

26

636

S=2762 I=83 E=0

putative peptidase, s15 family protein

pubmed

26

637

S=3252 I=99 E=0

Glutaryl-7-ACA acylase ; Hydrolase

Pubmed 12387744

 

prodomImg

pubmed

30

636

S=1980 I=61 E=0

Alpha-amino acid ester hydrolase EC=3.1.1.43

Pubmed 11772629

 

prodomImg

pubmed

43

636

S=474 I=29 E=2.38233e-48

Cocaine esterase EC=3.1.1.- ; Cytoplasm Hydrolase

Pubmed 10698749,11742345

 

prodomImg

pubmed

46

636

S=394 I=30 E=1.21787e-38

Glutaryl 7-ACA acylase ; Hydrolase Signal

Pubmed 1744041

 

prodomImg

pubmed

472

636

S=182 I=33 E=4.77077e-13

7-beta-(4-carboxybutanamido)cephlosporanic acid acylase homolog ; Hydrolase

Pubmed 11157924

 

prodomImg

sp

43

636

S=474 I=29 E=1.6316e-48

Cocaine esterase EC=3.1.1.- ; Cytoplasm Hydrolase

 

prodomImg

sp

49

202

S=126 I=30 E=2.10056e-06

Uncharacterized protein Mb1866c

 

prodomImg

sp

331

591

S=124 I=26 E=4.2564e-06

Uncharacterized protein Mb1866c

 

prodomImg

sp

49

202

S=126 I=30 E=2.10056e-06

Uncharacterized protein Rv1835c/MT1883

 

prodomImg

sp

331

591

S=124 I=26 E=4.2564e-06

Uncharacterized protein Rv1835c/MT1883

 

prodomImg

Iprscan [G3DSA:3.40.50.1820]

11

402

-

Iprscan [G3DSA:2.60.120.260]

400

637

-

Iprscan [PF02129]

56

342

-

Iprscan IPR013736 [PF08530]

384

632

Peptidase S15/CocE/NonD, C-terminal

Iprscan IPR005674 [TIGR00976]

52

637

CocE/NonD hydrolase

Iprscan [seg]

4

24

-

Iprscan [SignalP-NN(euk)]

1

22

-

PD856752

173

285

S=503 I=81 E=2.23233e-53

PD481137

297

600

S=317 I=30 E=8.10505e-31

PD014552

46

203

S=219 I=39 E=5.86259e-19

PD717755

601

637

S=192 I=100 E=1.13443e-15

PDA1I8Q1

286

318

S=174 I=94 E=1.73616e-13

PD910876

26

45

S=104 I=100 E=5.40406e-05

Iprscan [SSF53474]

20

404

-

Iprscan IPR008979 [SSF49785]

398

637

Galactose-binding domain-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one cZyq2swF)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBg4RyUO/XFF4834R_chr23450.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBg4RyUO/XFF4834R_chr23450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBg4RyUO/XFF4834R_chr23450.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBg4RyUO/XFF4834R_chr23450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.