Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr22510XFF4834R_chr_2593893_2595083_f3_XFF4834R-XFF4834R_chr22510XFF4834R_chr22510FAD dependent oxidoreductase

XFF4834R_chr_2593893_2595083_f3_XFF4834R-XFF4834R_chr22510 XFF4834R_chr22510
XFF4834R_chr_2396
XFF4834R_chr_2396
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_2398
XFF4834R_chr_2398
ID XFF4834R_chr_2593893_2595083_f3_XFF4834R-XFF4834R_chr22510
AC XFF4834R_chr22510
LT XFF4834R_chr22510
OR XFF4834R_chr from 2593893 to 2595083 on strand +
DE FAD dependent oxidoreductase
IP FAD dependent oxidoreductase
CL 1.4.3 Electron carrier GO:0009055
EC
GO InterPro
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN Taylor, T. V., Mitchell, T. K., and Daub, M. E. 2006. An oxidoreductase is involved in cercosporin degradation by the bacterium Xanthomonas campestris pv. zinniae. Appl. Environ. Microbiol. 72:6070-6078.
CC COG: [CH] Energy production and conversion;Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100510)
MW 43920.4 Da
SQ 396 aa
 
........10........20........30........40........50
| | | | |
MAHRVLVTGASVAGATTAFWLARSGWDVDVVERAPSFRDGGQNVDVRGNA
REVLRRMGLETIALERSTRERGTDWVTEDDRVLARFEAADSSNDSGPTAE
LEIRRGDIARIVYDAALQNGATFRFDDSIVCVEQSDDGVHVTFASGLRER
YTCVVVAEGVGSHTRELVFPGENMPRWMNLTIAYFSIPQRDHDSAYARQY
NAPGGRGAVVKPVRDGMLGVHIGIQKRPESEHTWSAAQQRAFIHAQFSGL
GWEFPRIVQAMEKVDDFYFDVLRQVRMPRWSNGPVVLTGDAAWCPTALSG
IGTTLAMVGGYVLAGELAKADTPSAAFARYEQIMRPFVDEGQNIPKLLPR
LLWPHTRVGLAVLRGAMHIAGSPVFKKFINDRFARDSRSIVLPRYE
XFF4834R

XFF4834R_chr28450 lcl|XFF4834R_chr30980202_3277404_f1_XFF4834R-XFF4834R_chr28450

1

395

S=915 I=48 E=2.83781e-104

XFF4834R

XFF4834R_chr28450 lcl|XFF4834R_chr30980202_3277404_f1_XFF4834R-XFF4834R_chr28450

1

395

S=915 I=48 E=2.83781e-104

X.species

NP_641998.2 lcl|XAC1667-XAC1667

1

395

S=939 I=49 E=1.38673e-106

oxidoreductase

X.species

YP_363434.1 lcl|XCV1703

1

395

S=924 I=49 E=1.00269e-104

putative FAD-dependent oxidoreductase

X.species

NP_642450.1 lcl|XAC2133-XAC2133

242

396

S=802 I=96 E=5.81766e-90

oxidoreductase

pubmed

1

395

S=1355 I=65 E=2.23935e-155

Oxidoreductase

Pubmed 16957231

 

prodomImg

pubmed

21

395

S=554 I=36 E=2.23368e-58

Putative oxidoreductase

Pubmed 15257441

 

prodomImg

pubmed

4

395

S=525 I=34 E=7.29286e-55

Oxidoreductase protein homolog Oxi ; Plasmid

Pubmed 11078655

 

prodomImg

pubmed

192

364

S=259 I=36 E=1.16714e-22

Oxidoreductase

Pubmed 17462021,17660442

 

prodomImg

pubmed

4

188

S=207 I=34 E=2.63559e-16

Oxidoreductase

Pubmed 17462021,17660442

 

prodomImg

pubmed

239

343

S=197 I=40 E=4.18023e-15

Putative monooxygenase

Pubmed 19000034

 

prodomImg

pubmed

21

351

S=118 I=26 E=1.54774e-05

Putative monooxygenase

Pubmed 12730200

 

prodomImg

pubmed

21

351

S=118 I=26 E=1.54774e-05

Putative uncharacterized protein

Pubmed 10746195

 

prodomImg

pubmed

21

351

S=118 I=26 E=1.54774e-05

1H-4-oxoquinaldine-3-monooxygenase ; Plasmid

Pubmed 17337569,15533053

 

prodomImg

pubmed

24

331

S=114 I=26 E=5.43195e-05

FAD-dependent oxidoreductase

Pubmed 18328078

 

prodomImg

sp

19

349

S=431 I=35 E=1.13869e-43

Uncharacterized protein Rv1260/MT1298

 

prodomImg

PD115443

178

271

S=198 I=40 E=1.45151e-16

PD631567

241

271

S=162 I=94 E=3.19847e-12

PDA126O9

44

103

S=158 I=59 E=1.2248e-11

PD631568

343

395

S=128 I=45 E=4.71937e-08

PDA1K7G0

1

43

S=109 I=51 E=9.97236e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YjxBMAlN)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPvKpb3/XFF4834R_chr22510.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPvKpb3/XFF4834R_chr22510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPvKpb3/XFF4834R_chr22510.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPvKpb3/XFF4834R_chr22510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.